Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3426358..3426977 | Replicon | chromosome |
Accession | NZ_CP125781 | ||
Organism | Trabulsiella odontotermitis strain TBY01 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | QMG90_RS16205 | Protein ID | WP_054180432.1 |
Coordinates | 3426759..3426977 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | QMG90_RS16200 | Protein ID | WP_054180431.1 |
Coordinates | 3426358..3426732 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMG90_RS16190 (QMG90_16190) | 3421485..3422678 | + | 1194 | WP_283280663.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QMG90_RS16195 (QMG90_16195) | 3422701..3425850 | + | 3150 | WP_283280664.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QMG90_RS16200 (QMG90_16200) | 3426358..3426732 | + | 375 | WP_054180431.1 | Hha toxicity modulator TomB | Antitoxin |
QMG90_RS16205 (QMG90_16205) | 3426759..3426977 | + | 219 | WP_054180432.1 | HHA domain-containing protein | Toxin |
QMG90_RS16210 (QMG90_16210) | 3427186..3427647 | + | 462 | WP_283280665.1 | YlaC family protein | - |
QMG90_RS16215 (QMG90_16215) | 3427726..3428427 | + | 702 | WP_283280667.1 | GNAT family protein | - |
QMG90_RS16220 (QMG90_16220) | 3428647..3429675 | + | 1029 | WP_283280668.1 | isopenicillin N synthase family oxygenase | - |
QMG90_RS16225 (QMG90_16225) | 3429696..3430502 | + | 807 | WP_283280669.1 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
QMG90_RS16230 (QMG90_16230) | 3430499..3431290 | + | 792 | WP_283280670.1 | ATP-binding cassette domain-containing protein | - |
QMG90_RS16235 (QMG90_16235) | 3431287..3431946 | + | 660 | WP_283280671.1 | methionine ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8618.98 Da Isoelectric Point: 8.9008
>T282393 WP_054180432.1 NZ_CP125781:3426759-3426977 [Trabulsiella odontotermitis]
MSDKPLTKNDYLLRLRRCQSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKNDYLLRLRRCQSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14409.17 Da Isoelectric Point: 4.8989
>AT282393 WP_054180431.1 NZ_CP125781:3426358-3426732 [Trabulsiella odontotermitis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFGNYGINAEDLQKWRKSGNRLFRCFTNASRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFGNYGINAEDLQKWRKSGNRLFRCFTNASRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|