Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3913294..3913930 | Replicon | chromosome |
Accession | NZ_CP125762 | ||
Organism | Bacillus subtilis strain KRS015 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QLQ05_RS21000 | Protein ID | WP_003156187.1 |
Coordinates | 3913294..3913644 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QLQ05_RS21005 | Protein ID | WP_003225183.1 |
Coordinates | 3913649..3913930 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ05_RS20960 (3908338) | 3908338..3908937 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
QLQ05_RS20965 (3908937) | 3908937..3909725 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
QLQ05_RS20970 (3909691) | 3909691..3910173 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
QLQ05_RS20975 (3910170) | 3910170..3910499 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
QLQ05_RS20980 (3910561) | 3910561..3911568 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
QLQ05_RS20985 (3911580) | 3911580..3911981 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
QLQ05_RS20990 (3911985) | 3911985..3912350 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QLQ05_RS20995 (3912355) | 3912355..3913179 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
QLQ05_RS21000 (3913294) | 3913294..3913644 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QLQ05_RS21005 (3913649) | 3913649..3913930 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QLQ05_RS21010 (3914046) | 3914046..3915215 | - | 1170 | WP_003234284.1 | alanine racemase | - |
QLQ05_RS21015 (3915330) | 3915330..3916346 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
QLQ05_RS21020 (3916512) | 3916512..3916877 | - | 366 | WP_003234281.1 | holo-ACP synthase | - |
QLQ05_RS21025 (3916972) | 3916972..3917571 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282385 WP_003156187.1 NZ_CP125762:c3913644-3913294 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|