Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3083222..3084138 | Replicon | chromosome |
Accession | NZ_CP125762 | ||
Organism | Bacillus subtilis strain KRS015 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | QLQ05_RS16545 | Protein ID | WP_003244695.1 |
Coordinates | 3083222..3083968 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | QLQ05_RS16550 | Protein ID | WP_003232646.1 |
Coordinates | 3083968..3084138 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ05_RS16520 (3078303) | 3078303..3078449 | - | 147 | WP_003244977.1 | hypothetical protein | - |
QLQ05_RS16525 (3078550) | 3078550..3079500 | - | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
QLQ05_RS16530 (3079889) | 3079889..3081205 | + | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
QLQ05_RS16535 (3081481) | 3081481..3082098 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QLQ05_RS16540 (3082111) | 3082111..3083112 | + | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
QLQ05_RS16545 (3083222) | 3083222..3083968 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QLQ05_RS16550 (3083968) | 3083968..3084138 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QLQ05_RS16555 (3084224) | 3084224..3084361 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QLQ05_RS16560 (3084398) | 3084398..3085291 | - | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
QLQ05_RS16565 (3085304) | 3085304..3085567 | - | 264 | WP_003232653.1 | phage holin | - |
QLQ05_RS16570 (3085580) | 3085580..3085849 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
QLQ05_RS16575 (3085902) | 3085902..3086741 | - | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
QLQ05_RS16580 (3086785) | 3086785..3086949 | - | 165 | WP_003232658.1 | XkdX family protein | - |
QLQ05_RS16585 (3086946) | 3086946..3087275 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T282384 WP_003244695.1 NZ_CP125762:3083222-3083968 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|