Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 73190..73715 | Replicon | plasmid pGYB02-2 |
| Accession | NZ_CP125736 | ||
| Organism | Klebsiella pneumoniae strain GYB02 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QMW18_RS26520 | Protein ID | WP_001159871.1 |
| Coordinates | 73410..73715 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | QMW18_RS26515 | Protein ID | WP_230927787.1 |
| Coordinates | 73190..73408 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMW18_RS26490 (68400) | 68400..69086 | + | 687 | Protein_78 | IS1 family transposase | - |
| QMW18_RS26495 (69340) | 69340..70362 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| QMW18_RS26500 (70347) | 70347..71912 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QMW18_RS26505 (71987) | 71987..72403 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| QMW18_RS26510 (72400) | 72400..72630 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QMW18_RS26515 (73190) | 73190..73408 | + | 219 | WP_230927787.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QMW18_RS26520 (73410) | 73410..73715 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QMW18_RS26525 (73716) | 73716..74522 | + | 807 | WP_000016970.1 | site-specific integrase | - |
| QMW18_RS26530 (75244) | 75244..75999 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QMW18_RS26535 (76587) | 76587..77753 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / blaNDM-5 / tet(B) / qepA1 / rmtB / blaTEM-1B / blaCTX-M-55 | iucA / iucB / iucC / iucD / iutA | 1..211607 | 211607 | |
| - | flank | IS/Tn | - | - | 68739..69086 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T282333 WP_001159871.1 NZ_CP125736:73410-73715 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|