Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 71987..72630 Replicon plasmid pGYB02-2
Accession NZ_CP125736
Organism Klebsiella pneumoniae strain GYB02

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QMW18_RS26505 Protein ID WP_001034044.1
Coordinates 71987..72403 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QMW18_RS26510 Protein ID WP_001261286.1
Coordinates 72400..72630 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMW18_RS26490 (68400) 68400..69086 + 687 Protein_78 IS1 family transposase -
QMW18_RS26495 (69340) 69340..70362 - 1023 WP_000361402.1 helicase UvrD -
QMW18_RS26500 (70347) 70347..71912 - 1566 WP_001128474.1 AAA family ATPase -
QMW18_RS26505 (71987) 71987..72403 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QMW18_RS26510 (72400) 72400..72630 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QMW18_RS26515 (73190) 73190..73408 + 219 WP_230927787.1 type II toxin-antitoxin system antitoxin CcdA -
QMW18_RS26520 (73410) 73410..73715 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QMW18_RS26525 (73716) 73716..74522 + 807 WP_000016970.1 site-specific integrase -
QMW18_RS26530 (75244) 75244..75999 + 756 WP_000852146.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / blaNDM-5 / tet(B) / qepA1 / rmtB / blaTEM-1B / blaCTX-M-55 iucA / iucB / iucC / iucD / iutA 1..211607 211607
- flank IS/Tn - - 68739..69086 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T282332 WP_001034044.1 NZ_CP125736:c72403-71987 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT282332 WP_001261286.1 NZ_CP125736:c72630-72400 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References