Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 3195688..3196319 Replicon chromosome
Accession NZ_CP125734
Organism Klebsiella pneumoniae strain GYB02

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag QMW18_RS15730 Protein ID WP_012542177.1
Coordinates 3196143..3196319 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2X1QFN9
Locus tag QMW18_RS15725 Protein ID WP_012542176.1
Coordinates 3195688..3196095 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMW18_RS15695 (QMW18_15695) 3192750..3193238 - 489 WP_094945267.1 DUF1441 family protein -
QMW18_RS15700 (QMW18_15700) 3193470..3193889 - 420 WP_057214532.1 hypothetical protein -
QMW18_RS15705 (QMW18_15705) 3193889..3194197 - 309 WP_283321345.1 hypothetical protein -
QMW18_RS15710 (QMW18_15710) 3194279..3194755 - 477 WP_087749379.1 DUF2514 domain-containing protein -
QMW18_RS15715 (QMW18_15715) 3194788..3195318 - 531 WP_283321348.1 lysozyme -
QMW18_RS15720 (QMW18_15720) 3195296..3195532 - 237 WP_004111739.1 class II holin family protein -
QMW18_RS15725 (QMW18_15725) 3195688..3196095 - 408 WP_012542176.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QMW18_RS15730 (QMW18_15730) 3196143..3196319 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
QMW18_RS15735 (QMW18_15735) 3196690..3197292 - 603 WP_057214526.1 hypothetical protein -
QMW18_RS15740 (QMW18_15740) 3197309..3198340 - 1032 WP_283321357.1 DUF968 domain-containing protein -
QMW18_RS15745 (QMW18_15745) 3198540..3198932 - 393 WP_016160645.1 hypothetical protein -
QMW18_RS15750 (QMW18_15750) 3199034..3199228 - 195 WP_225376235.1 hypothetical protein -
QMW18_RS15755 (QMW18_15755) 3199301..3199507 - 207 WP_283321361.1 DinI-like family protein -
QMW18_RS15760 (QMW18_15760) 3199658..3199987 - 330 WP_283321363.1 hypothetical protein -
QMW18_RS15765 (QMW18_15765) 3200216..3201247 - 1032 WP_283321365.1 DUF5677 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3166214..3212066 45852


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T282325 WP_012542177.1 NZ_CP125734:c3196319-3196143 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14977.99 Da        Isoelectric Point: 4.4277

>AT282325 WP_012542176.1 NZ_CP125734:c3196095-3195688 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARMINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A2X1QFN9

References