Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 134541..135184 Replicon plasmid pGYB01-2
Accession NZ_CP125733
Organism Escherichia coli strain GYB01

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QMW19_RS24890 Protein ID WP_001034044.1
Coordinates 134541..134957 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QMW19_RS24895 Protein ID WP_001261286.1
Coordinates 134954..135184 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMW19_RS24875 (130954) 130954..131640 + 687 Protein_148 IS1 family transposase -
QMW19_RS24880 (131894) 131894..132916 - 1023 WP_000361402.1 helicase UvrD -
QMW19_RS24885 (132901) 132901..134466 - 1566 WP_001128474.1 AAA family ATPase -
QMW19_RS24890 (134541) 134541..134957 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QMW19_RS24895 (134954) 134954..135184 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QMW19_RS24900 (135744) 135744..135962 + 219 WP_230927787.1 type II toxin-antitoxin system antitoxin CcdA -
QMW19_RS24905 (135964) 135964..136269 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QMW19_RS24910 (136270) 136270..137076 + 807 WP_000016970.1 site-specific integrase -
QMW19_RS24915 (137798) 137798..138553 + 756 WP_000852146.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / aac(6')-Ib-cr / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 / blaNDM-5 / tet(B) iucA / iucB / iucC / iucD / iutA 1..165770 165770
- flank IS/Tn - - 131293..131640 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T282311 WP_001034044.1 NZ_CP125733:c134957-134541 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT282311 WP_001261286.1 NZ_CP125733:c135184-134954 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References