Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpIK/PemK(toxin) |
Location | 542042..542618 | Replicon | chromosome |
Accession | NZ_CP125672 | ||
Organism | Leptospira kirschneri strain 804Khv |
Toxin (Protein)
Gene name | chpK | Uniprot ID | A0A828YA21 |
Locus tag | QMK36_RS02270 | Protein ID | WP_004755078.1 |
Coordinates | 542277..542618 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | chpI | Uniprot ID | A0A828Y9A4 |
Locus tag | QMK36_RS02265 | Protein ID | WP_004759478.1 |
Coordinates | 542042..542290 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMK36_RS02255 (QMK36_02255) | 538521..539303 | + | 783 | WP_004754327.1 | ABC transporter ATP-binding protein | - |
QMK36_RS02260 (QMK36_02260) | 539300..541837 | + | 2538 | WP_004759514.1 | FtsX-like permease family protein | - |
QMK36_RS02265 (QMK36_02265) | 542042..542290 | + | 249 | WP_004759478.1 | hypothetical protein | Antitoxin |
QMK36_RS02270 (QMK36_02270) | 542277..542618 | + | 342 | WP_004755078.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QMK36_RS02275 (QMK36_02275) | 542725..542874 | + | 150 | WP_004759513.1 | hypothetical protein | - |
QMK36_RS02280 (QMK36_02280) | 543691..543978 | - | 288 | WP_004754874.1 | hypothetical protein | - |
QMK36_RS02285 (QMK36_02285) | 544408..544956 | - | 549 | WP_004754121.1 | YqgE/AlgH family protein | - |
QMK36_RS02290 (QMK36_02290) | 544980..545948 | - | 969 | WP_004755369.1 | Gfo/Idh/MocA family oxidoreductase | - |
QMK36_RS02295 (QMK36_02295) | 546224..547342 | - | 1119 | WP_004760477.1 | molecular chaperone DnaJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12354.23 Da Isoelectric Point: 5.1486
>T282275 WP_004755078.1 NZ_CP125672:542277-542618 [Leptospira kirschneri]
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNISTVVSIAITSNLNLSEAPGNVLIGKKESSLSKDSVVNVSQIV
TLDKERFIERVGKLKSSKINEVEVGLKLVTGLD
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNISTVVSIAITSNLNLSEAPGNVLIGKKESSLSKDSVVNVSQIV
TLDKERFIERVGKLKSSKINEVEVGLKLVTGLD
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828YA21 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828Y9A4 |