Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3205381..3206024 | Replicon | chromosome |
| Accession | NZ_CP125669 | ||
| Organism | Acinetobacter sp. KCTC 92772 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QLH32_RS15250 | Protein ID | WP_171062334.1 |
| Coordinates | 3205381..3205788 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QLH32_RS15255 | Protein ID | WP_283266889.1 |
| Coordinates | 3205791..3206024 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH32_RS15205 (QLH32_15205) | 3201337..3201717 | - | 381 | WP_004655255.1 | aspartate 1-decarboxylase | - |
| QLH32_RS15210 (QLH32_15210) | 3201863..3202444 | - | 582 | WP_004676505.1 | aminoacyl-tRNA hydrolase | - |
| QLH32_RS15215 (QLH32_15215) | 3202464..3202760 | - | 297 | WP_004676507.1 | 50S ribosomal protein L25 | - |
| QLH32_RS15220 (QLH32_15220) | 3202857..3203810 | - | 954 | WP_004676510.1 | ribose-phosphate pyrophosphokinase | - |
| QLH32_RS15245 (QLH32_15245) | 3204524..3205357 | - | 834 | WP_283269362.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| QLH32_RS15250 (QLH32_15250) | 3205381..3205788 | - | 408 | WP_171062334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| QLH32_RS15255 (QLH32_15255) | 3205791..3206024 | - | 234 | WP_283266889.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QLH32_RS15260 (QLH32_15260) | 3206085..3206666 | - | 582 | WP_283266891.1 | lipoprotein insertase outer membrane protein LolB | - |
| QLH32_RS15265 (QLH32_15265) | 3206671..3208389 | - | 1719 | WP_283266892.1 | tetratricopeptide repeat protein | - |
| QLH32_RS15270 (QLH32_15270) | 3208469..3209752 | + | 1284 | WP_283266894.1 | glutamyl-tRNA reductase | - |
| QLH32_RS15275 (QLH32_15275) | 3209758..3210366 | - | 609 | WP_283266896.1 | Uma2 family endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15443.75 Da Isoelectric Point: 7.1023
>T282274 WP_171062334.1 NZ_CP125669:c3205788-3205381 [Acinetobacter sp. KCTC 92772]
MLKYMLDTNICIYAIKKKPIEVIQQFSKYQDYLCISSITLMELYYGAEKSSNPQTNLTEIEKFVANLIVLDYDNYAAAHT
AQIRAELSKTGKTIGSYDAMIAGHARSQGFICVTNNIREFERVAGLRLENWWVQS
MLKYMLDTNICIYAIKKKPIEVIQQFSKYQDYLCISSITLMELYYGAEKSSNPQTNLTEIEKFVANLIVLDYDNYAAAHT
AQIRAELSKTGKTIGSYDAMIAGHARSQGFICVTNNIREFERVAGLRLENWWVQS
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|