Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 2762908..2763547 | Replicon | chromosome |
| Accession | NZ_CP125669 | ||
| Organism | Acinetobacter sp. KCTC 92772 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | QLH32_RS13220 | Protein ID | WP_283266571.1 |
| Coordinates | 2763152..2763547 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | QLH32_RS13215 | Protein ID | WP_279958600.1 |
| Coordinates | 2762908..2763165 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH32_RS13200 (QLH32_13200) | 2759368..2760858 | + | 1491 | WP_283266570.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QLH32_RS13205 (QLH32_13205) | 2760996..2761496 | + | 501 | WP_279958602.1 | DUF2059 domain-containing protein | - |
| QLH32_RS13210 (QLH32_13210) | 2761548..2762720 | - | 1173 | WP_279958601.1 | acyl-CoA dehydrogenase family protein | - |
| QLH32_RS13215 (QLH32_13215) | 2762908..2763165 | + | 258 | WP_279958600.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| QLH32_RS13220 (QLH32_13220) | 2763152..2763547 | + | 396 | WP_283266571.1 | hypothetical protein | Toxin |
| QLH32_RS13225 (QLH32_13225) | 2763754..2763978 | + | 225 | WP_279958598.1 | hypothetical protein | - |
| QLH32_RS13230 (QLH32_13230) | 2764323..2765399 | + | 1077 | WP_283266572.1 | hypothetical protein | - |
| QLH32_RS13235 (QLH32_13235) | 2765475..2766056 | + | 582 | WP_283266573.1 | rhombosortase | - |
| QLH32_RS13240 (QLH32_13240) | 2766237..2768447 | + | 2211 | WP_283266574.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 15748.88 Da Isoelectric Point: 8.1459
>T282272 WP_283266571.1 NZ_CP125669:2763152-2763547 [Acinetobacter sp. KCTC 92772]
MSTANRVFELQASRFMIVLQLLIFIFLMILLYQLLALGIWLLCLGIMVIAWFRFLQQPQVKRFEHLEDQDWSFEFAVSDL
PIQRRQIVKMIDHHCYVVLYFSASHDKTCIIWWDQLPVTQWKNLKTLVKLC
MSTANRVFELQASRFMIVLQLLIFIFLMILLYQLLALGIWLLCLGIMVIAWFRFLQQPQVKRFEHLEDQDWSFEFAVSDL
PIQRRQIVKMIDHHCYVVLYFSASHDKTCIIWWDQLPVTQWKNLKTLVKLC
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|