Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 364343..365019 | Replicon | chromosome |
Accession | NZ_CP125669 | ||
Organism | Acinetobacter sp. KCTC 92772 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | QLH32_RS01700 | Protein ID | WP_283267788.1 |
Coordinates | 364343..364756 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | QLH32_RS01705 | Protein ID | WP_283267789.1 |
Coordinates | 364753..365019 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLH32_RS01670 (QLH32_01670) | 359427..360023 | + | 597 | WP_004677443.1 | recombination mediator RecR | - |
QLH32_RS01675 (QLH32_01675) | 360316..361458 | + | 1143 | WP_283267783.1 | HRDC domain-containing protein | - |
QLH32_RS01680 (QLH32_01680) | 361550..361855 | + | 306 | WP_283267784.1 | YcgL domain-containing protein | - |
QLH32_RS01685 (QLH32_01685) | 361848..362234 | + | 387 | WP_283267785.1 | hypothetical protein | - |
QLH32_RS01690 (QLH32_01690) | 362276..363127 | + | 852 | WP_283267786.1 | MoxR family ATPase | - |
QLH32_RS01695 (QLH32_01695) | 363140..364327 | + | 1188 | WP_283267787.1 | VWA domain-containing protein | - |
QLH32_RS01700 (QLH32_01700) | 364343..364756 | - | 414 | WP_283267788.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QLH32_RS01705 (QLH32_01705) | 364753..365019 | - | 267 | WP_283267789.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QLH32_RS01710 (QLH32_01710) | 365206..366213 | + | 1008 | WP_283267790.1 | 50S ribosomal protein L3 N(5)-glutamine methyltransferase | - |
QLH32_RS01715 (QLH32_01715) | 366230..366598 | + | 369 | WP_283267791.1 | hypothetical protein | - |
QLH32_RS01720 (QLH32_01720) | 366611..367702 | + | 1092 | WP_283267792.1 | chorismate synthase | - |
QLH32_RS01725 (QLH32_01725) | 367818..369047 | - | 1230 | WP_283267793.1 | GGDEF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15712.26 Da Isoelectric Point: 6.8428
>T282271 WP_283267788.1 NZ_CP125669:c364756-364343 [Acinetobacter sp. KCTC 92772]
MKYMLDTNILIYFIKNKPMSVIERVNQLSQDDELCMSFISYAELLKGAYGSQRKTVVLKQLENLILRIPVLYSTQQQLCE
HYAHHALLLKQAGTPIGNNDLWIASHALAEKCILVTNNCKEFNRITDLTIENWADPA
MKYMLDTNILIYFIKNKPMSVIERVNQLSQDDELCMSFISYAELLKGAYGSQRKTVVLKQLENLILRIPVLYSTQQQLCE
HYAHHALLLKQAGTPIGNNDLWIASHALAEKCILVTNNCKEFNRITDLTIENWADPA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|