Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 171150..171779 | Replicon | chromosome |
| Accession | NZ_CP125669 | ||
| Organism | Acinetobacter sp. KCTC 92772 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QLH32_RS00785 | Protein ID | WP_283267604.1 |
| Coordinates | 171378..171779 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QLH32_RS00780 | Protein ID | WP_283267603.1 |
| Coordinates | 171150..171377 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLH32_RS00770 (QLH32_00770) | 166629..169760 | - | 3132 | WP_283267601.1 | efflux RND transporter permease subunit | - |
| QLH32_RS00775 (QLH32_00775) | 169762..170949 | - | 1188 | WP_283267602.1 | efflux RND transporter periplasmic adaptor subunit | - |
| QLH32_RS00780 (QLH32_00780) | 171150..171377 | + | 228 | WP_283267603.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QLH32_RS00785 (QLH32_00785) | 171378..171779 | + | 402 | WP_283267604.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QLH32_RS00790 (QLH32_00790) | 171821..172990 | - | 1170 | WP_283267605.1 | succinyldiaminopimelate transaminase | - |
| QLH32_RS00795 (QLH32_00795) | 173054..175717 | - | 2664 | WP_283267606.1 | [protein-PII] uridylyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15039.43 Da Isoelectric Point: 8.7793
>T282270 WP_283267604.1 NZ_CP125669:171378-171779 [Acinetobacter sp. KCTC 92772]
MLKYMLDTNIVIYVIKQKPPQVRTKFNSVATQLCVSSVTVAELIYGAENSQYPEKNLYIVENFLSRLQILDYGLEAAIQY
GNIKAILRKTGQLISDNDLHIAAHARSKGLILVTNNTKEFERVPALQLENWVG
MLKYMLDTNIVIYVIKQKPPQVRTKFNSVATQLCVSSVTVAELIYGAENSQYPEKNLYIVENFLSRLQILDYGLEAAIQY
GNIKAILRKTGQLISDNDLHIAAHARSKGLILVTNNTKEFERVPALQLENWVG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|