Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4339552..4340315 | Replicon | chromosome |
| Accession | NZ_CP125657 | ||
| Organism | Xanthomonas campestris strain GBBC 3077 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | QMY63_RS18605 | Protein ID | WP_283273020.1 |
| Coordinates | 4339839..4340315 (+) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | Q8P668 |
| Locus tag | QMY63_RS18600 | Protein ID | WP_011038219.1 |
| Coordinates | 4339552..4339842 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMY63_RS18575 (QMY63_18575) | 4335005..4335424 | - | 420 | WP_116670568.1 | pilin | - |
| QMY63_RS18580 (QMY63_18580) | 4335778..4337037 | + | 1260 | WP_116670567.1 | type II secretion system F family protein | - |
| QMY63_RS18585 (QMY63_18585) | 4337044..4337907 | + | 864 | WP_116670566.1 | A24 family peptidase | - |
| QMY63_RS18590 (QMY63_18590) | 4337921..4338544 | + | 624 | WP_116670565.1 | dephospho-CoA kinase | - |
| QMY63_RS18595 (QMY63_18595) | 4339076..4339477 | + | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| QMY63_RS18600 (QMY63_18600) | 4339552..4339842 | + | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
| QMY63_RS18605 (QMY63_18605) | 4339839..4340315 | + | 477 | WP_283273020.1 | GNAT family N-acetyltransferase | Toxin |
| QMY63_RS18610 (QMY63_18610) | 4340472..4341806 | - | 1335 | WP_237351399.1 | HAMP domain-containing sensor histidine kinase | - |
| QMY63_RS18615 (QMY63_18615) | 4341799..4342476 | - | 678 | WP_003490678.1 | response regulator transcription factor | - |
| QMY63_RS18620 (QMY63_18620) | 4343126..4344001 | - | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 17505.09 Da Isoelectric Point: 10.2732
>T282247 WP_283273020.1 NZ_CP125657:4339839-4340315 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKVFYERIGFEPSRWIPWCWSSRWKT
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKVFYERIGFEPSRWIPWCWSSRWKT
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|