Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 4692713..4693076 Replicon chromosome
Accession NZ_CP125656
Organism Xanthomonas campestris strain GBBC 3139

Toxin (Protein)


Gene name EcnB Uniprot ID G0CKD4
Locus tag QMY62_RS20570 Protein ID WP_011270059.1
Coordinates 4692713..4692847 (-) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID Q8P3Z2
Locus tag QMY62_RS20575 Protein ID WP_011038999.1
Coordinates 4692924..4693076 (-) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMY62_RS20550 (QMY62_20550) 4687977..4689629 - 1653 WP_283269671.1 M28 family metallopeptidase -
QMY62_RS20555 (QMY62_20555) 4689794..4690738 - 945 WP_068574725.1 MBL fold metallo-hydrolase -
QMY62_RS20560 (QMY62_20560) 4690822..4692111 - 1290 WP_283268084.1 tryptophan--tRNA ligase -
QMY62_RS20565 (QMY62_20565) 4692271..4692480 - 210 WP_011038998.1 CsbD family protein -
QMY62_RS20570 (QMY62_20570) 4692713..4692847 - 135 WP_011270059.1 entericidin A/B family lipoprotein Toxin
QMY62_RS20575 (QMY62_20575) 4692924..4693076 - 153 WP_011038999.1 entericidin A/B family lipoprotein Antitoxin
QMY62_RS20580 (QMY62_20580) 4693187..4694110 - 924 WP_011039000.1 arginase -
QMY62_RS20585 (QMY62_20585) 4694424..4694885 + 462 WP_011039001.1 roadblock/LC7 domain-containing protein -
QMY62_RS20590 (QMY62_20590) 4694968..4695327 + 360 WP_011039002.1 hypothetical protein -
QMY62_RS20595 (QMY62_20595) 4695430..4696347 + 918 WP_283268088.1 hypothetical protein -
QMY62_RS20600 (QMY62_20600) 4696344..4696886 + 543 WP_076035808.1 GTPase -
QMY62_RS20605 (QMY62_20605) 4697221..4697904 + 684 WP_070693788.1 dTMP kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4431.27 Da        Isoelectric Point: 9.3487

>T282245 WP_011270059.1 NZ_CP125656:c4692847-4692713 [Xanthomonas campestris]
MKRAIALLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5173.15 Da        Isoelectric Point: 8.2782

>AT282245 WP_011038999.1 NZ_CP125656:c4693076-4692924 [Xanthomonas campestris]
MKRLLTLMVLGLFSAGMMTGCNTMAGAGKDMQGAGDKVEKTADKCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2XDQ0

Antitoxin

Source ID Structure
AlphaFold DB Q8P3Z2

References