Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1347339..1348117 | Replicon | chromosome |
Accession | NZ_CP125656 | ||
Organism | Xanthomonas campestris strain GBBC 3139 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QMY62_RS05655 | Protein ID | WP_223646366.1 |
Coordinates | 1347339..1347830 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | QMY62_RS05660 | Protein ID | WP_011038219.1 |
Coordinates | 1347827..1348117 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMY62_RS05640 (QMY62_05640) | 1343667..1344542 | + | 876 | WP_011038222.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
QMY62_RS05645 (QMY62_05645) | 1345192..1345869 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
QMY62_RS05650 (QMY62_05650) | 1345862..1347196 | + | 1335 | WP_012437598.1 | HAMP domain-containing sensor histidine kinase | - |
QMY62_RS05655 (QMY62_05655) | 1347339..1347830 | - | 492 | WP_223646366.1 | GNAT family N-acetyltransferase | Toxin |
QMY62_RS05660 (QMY62_05660) | 1347827..1348117 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
QMY62_RS05665 (QMY62_05665) | 1348193..1348594 | - | 402 | WP_283269159.1 | SymE family type I addiction module toxin | - |
QMY62_RS05670 (QMY62_05670) | 1349123..1349746 | - | 624 | WP_228424129.1 | dephospho-CoA kinase | - |
QMY62_RS05675 (QMY62_05675) | 1349760..1350623 | - | 864 | WP_040940797.1 | A24 family peptidase | - |
QMY62_RS05680 (QMY62_05680) | 1350630..1351832 | - | 1203 | WP_283269162.1 | type II secretion system F family protein | - |
QMY62_RS05685 (QMY62_05685) | 1352237..1352668 | + | 432 | WP_024939397.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1309668..1362762 | 53094 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17610.25 Da Isoelectric Point: 8.1192
>T282244 WP_223646366.1 NZ_CP125656:c1347830-1347339 [Xanthomonas campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLAVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLAVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|