Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 3764648..3765294 Replicon chromosome
Accession NZ_CP125655
Organism Cellulomonas sp. ES6

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag P9841_RS17465 Protein ID WP_283319853.1
Coordinates 3764648..3765070 (-) Length 141 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag P9841_RS17470 Protein ID WP_283319854.1
Coordinates 3765067..3765294 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9841_RS17430 (P9841_17425) 3759722..3760336 + 615 WP_283319846.1 helix-turn-helix domain-containing protein -
P9841_RS17435 (P9841_17430) 3760395..3761360 + 966 WP_283319847.1 DUF5692 family protein -
P9841_RS17440 (P9841_17435) 3761386..3762750 - 1365 WP_283319848.1 FAD-binding oxidoreductase -
P9841_RS17445 (P9841_17440) 3762855..3763142 + 288 WP_283319849.1 DUF1905 domain-containing protein -
P9841_RS17450 (P9841_17445) 3763171..3763407 + 237 WP_283319850.1 hypothetical protein -
P9841_RS17455 (P9841_17450) 3763443..3763745 + 303 WP_283319851.1 DUF1905 domain-containing protein -
P9841_RS17460 (P9841_17455) 3763762..3764598 - 837 WP_283319852.1 hypothetical protein -
P9841_RS17465 (P9841_17460) 3764648..3765070 - 423 WP_283319853.1 type II toxin-antitoxin system VapC family toxin Toxin
P9841_RS17470 (P9841_17465) 3765067..3765294 - 228 WP_283319854.1 Arc family DNA-binding protein Antitoxin
P9841_RS17475 (P9841_17470) 3765359..3765712 - 354 WP_283319855.1 hypothetical protein -
P9841_RS17480 (P9841_17475) 3765867..3766769 + 903 WP_283319856.1 LysR family transcriptional regulator -
P9841_RS17485 (P9841_17480) 3766819..3768066 + 1248 WP_283319857.1 FAD-dependent oxidoreductase -
P9841_RS17490 (P9841_17485) 3768085..3769167 - 1083 WP_283319858.1 glycosyltransferase family 2 protein -
P9841_RS17495 (P9841_17490) 3769171..3770175 - 1005 WP_283319859.1 phosphodiester glycosidase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-122)

Antitoxin

Arc-like DNA binding domain

(11-41)


Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 14733.69 Da        Isoelectric Point: 4.7172

>T282242 WP_283319853.1 NZ_CP125655:c3765070-3764648 [Cellulomonas sp. ES6]
VIVLDTNVLSEPLRAEPDPGVLGWLDDVDGSAAVTAVSVAELLTGAQHLPAGRRRDGLVRAIEAMAESFRDSVLPFDVDA
ARRYAGFQAARRAAGRPLSVEDGMIAAICASRGATLATRNTRDFAGLGLPLVDPWEAGRP

Download         Length: 423 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8343.35 Da        Isoelectric Point: 6.7253

>AT282242 WP_283319854.1 NZ_CP125655:c3765294-3765067 [Cellulomonas sp. ES6]
VATVTVRNLDDEVQRRLKERAAHHHRSMEAEARAILSAAVLDTGLTRSWLDAARDLRGDDLTLPTRSAPREVDLG

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References