Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1266230..1266879 | Replicon | chromosome |
| Accession | NZ_CP125655 | ||
| Organism | Cellulomonas sp. ES6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P9841_RS05965 | Protein ID | WP_283321123.1 |
| Coordinates | 1266230..1266649 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P9841_RS05970 | Protein ID | WP_283321124.1 |
| Coordinates | 1266646..1266879 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9841_RS05940 (P9841_05940) | 1261457..1262800 | - | 1344 | WP_283321119.1 | ABC transporter substrate-binding protein | - |
| P9841_RS05945 (P9841_05945) | 1262785..1263303 | - | 519 | WP_283321120.1 | hypothetical protein | - |
| P9841_RS05950 (P9841_05950) | 1263645..1264025 | - | 381 | WP_283321872.1 | MarR family transcriptional regulator | - |
| P9841_RS05955 (P9841_05955) | 1264221..1265054 | + | 834 | WP_283321121.1 | SDR family oxidoreductase | - |
| P9841_RS05960 (P9841_05960) | 1265104..1266233 | - | 1130 | Protein_1167 | methyltransferase | - |
| P9841_RS05965 (P9841_05965) | 1266230..1266649 | - | 420 | WP_283321123.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P9841_RS05970 (P9841_05970) | 1266646..1266879 | - | 234 | WP_283321124.1 | toxin-antitoxin system | Antitoxin |
| P9841_RS05975 (P9841_05975) | 1266943..1268028 | - | 1086 | WP_283321125.1 | redox-regulated ATPase YchF | - |
| P9841_RS05980 (P9841_05980) | 1268354..1269694 | - | 1341 | WP_283321126.1 | hypothetical protein | - |
| P9841_RS05985 (P9841_05985) | 1269670..1270551 | - | 882 | WP_283321127.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14892.04 Da Isoelectric Point: 5.1721
>T282241 WP_283321123.1 NZ_CP125655:c1266649-1266230 [Cellulomonas sp. ES6]
MIVLDTHVISEVFRPEPEARVVAWLEGLTGEVAIAAVTLAELLAGVRRLPDGQRRTALAGMLHDALEPYRATRAILPFDV
AAAEQYADVLAARERAGRPIHTADAQIAAICLAHGATCATRNVRDFDGTGVDLVNPWTA
MIVLDTHVISEVFRPEPEARVVAWLEGLTGEVAIAAVTLAELLAGVRRLPDGQRRTALAGMLHDALEPYRATRAILPFDV
AAAEQYADVLAARERAGRPIHTADAQIAAICLAHGATCATRNVRDFDGTGVDLVNPWTA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|