Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2890064..2890722 | Replicon | chromosome |
Accession | NZ_CP125652 | ||
Organism | Rhizobium sp. BT04 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QMO82_RS22475 | Protein ID | WP_183608479.1 |
Coordinates | 2890306..2890722 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QMO82_RS22470 | Protein ID | WP_183608480.1 |
Coordinates | 2890064..2890306 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO82_RS22445 | 2885493..2886476 | - | 984 | WP_183608485.1 | UDP-glucose 4-epimerase GalE | - |
QMO82_RS22450 | 2886698..2887342 | + | 645 | WP_183608484.1 | ThuA domain-containing protein | - |
QMO82_RS22455 | 2887401..2887970 | + | 570 | WP_183608483.1 | GNAT family N-acetyltransferase | - |
QMO82_RS22460 | 2888005..2888256 | - | 252 | WP_183608482.1 | DUF2934 domain-containing protein | - |
QMO82_RS22465 | 2888458..2889894 | + | 1437 | WP_183608481.1 | hypothetical protein | - |
QMO82_RS22470 | 2890064..2890306 | + | 243 | WP_183608480.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QMO82_RS22475 | 2890306..2890722 | + | 417 | WP_183608479.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMO82_RS22485 | 2891196..2891513 | + | 318 | WP_003543907.1 | 50S ribosomal protein L21 | - |
QMO82_RS22490 | 2891548..2891817 | + | 270 | WP_003567620.1 | 50S ribosomal protein L27 | - |
QMO82_RS22495 | 2891943..2892599 | + | 657 | WP_183608478.1 | GNAT family protein | - |
QMO82_RS22500 | 2892596..2893183 | + | 588 | WP_183608477.1 | GNAT family N-acetyltransferase | - |
QMO82_RS22505 | 2893221..2894087 | - | 867 | WP_283196550.1 | endonuclease/exonuclease/phosphatase family protein | - |
QMO82_RS22510 | 2894172..2895254 | + | 1083 | WP_183608475.1 | GTPase ObgE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14895.87 Da Isoelectric Point: 6.6455
>T282237 WP_183608479.1 NZ_CP125652:2890306-2890722 [Rhizobium sp. BT04]
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAHLRRQGTPIGPYDVLIAAHARRAGTVLVTANTGEFARVPGLQVLDWAAAS
MIHLDTNVAVALLNGRPRQVRERFDEARNAGTPLGLSIIVYHELMYGAAASERRHANEEKIALFIASGGISLIDFNEGDA
QEAADIRAHLRRQGTPIGPYDVLIAAHARRAGTVLVTANTGEFARVPGLQVLDWAAAS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|