Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 653751..654427 Replicon plasmid pRspBT04f
Accession NZ_CP125651
Organism Rhizobium sp. BT04

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QMO82_RS08270 Protein ID WP_097621818.1
Coordinates 653751..654176 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QMO82_RS08275 Protein ID WP_183609127.1
Coordinates 654173..654427 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMO82_RS08240 649046..649780 + 735 WP_183609121.1 PspA/IM30 family protein -
QMO82_RS08245 649895..650620 - 726 WP_183609122.1 amino acid ABC transporter ATP-binding protein -
QMO82_RS08250 650598..651257 - 660 WP_183609123.1 amino acid ABC transporter permease -
QMO82_RS08255 651254..651925 - 672 WP_183609124.1 amino acid ABC transporter permease -
QMO82_RS08260 652004..652789 - 786 WP_183609125.1 transporter substrate-binding domain-containing protein -
QMO82_RS08265 652793..653536 - 744 WP_183609126.1 GntR family transcriptional regulator -
QMO82_RS08270 653751..654176 - 426 WP_097621818.1 type II toxin-antitoxin system VapC family toxin Toxin
QMO82_RS08275 654173..654427 - 255 WP_183609127.1 plasmid stabilization protein Antitoxin
QMO82_RS08280 654566..655336 - 771 WP_183609128.1 amino acid ABC transporter ATP-binding protein -
QMO82_RS08285 655349..656008 - 660 WP_097621821.1 amino acid ABC transporter permease -
QMO82_RS08290 656014..656676 - 663 WP_183609129.1 amino acid ABC transporter permease -
QMO82_RS08295 656807..657646 - 840 WP_183609130.1 transporter substrate-binding domain-containing protein -
QMO82_RS08300 658116..658763 - 648 WP_183609131.1 TetR/AcrR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - gmd 1..659089 659089


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 14985.18 Da        Isoelectric Point: 4.4709

>T282236 WP_097621818.1 NZ_CP125651:c654176-653751 [Rhizobium sp. BT04]
MIILDTNVVSEAMKPAPDEAVKFWLDEQAAETLFLSSVTIAELMFGIGALPPGKRKERLSEALDGLMELFENRILAFDIT
AARHYADLAVKARAAGRGFPTPDGYIAAIAASKGFVVATRDTSAFDAAGVEVINPWAASAA

Download         Length: 426 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9416.82 Da        Isoelectric Point: 10.9145

>AT282236 WP_183609127.1 NZ_CP125651:c654427-654173 [Rhizobium sp. BT04]
MPAVTIRNLSEATHRALKVRAAHHGRSAEAEMREILEAAVRPETRLRLGSVLAERSRRLGLTNEDFAVLDQARDKLPAKP
MSFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References