Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 653751..654427 | Replicon | plasmid pRspBT04f |
| Accession | NZ_CP125651 | ||
| Organism | Rhizobium sp. BT04 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QMO82_RS08270 | Protein ID | WP_097621818.1 |
| Coordinates | 653751..654176 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QMO82_RS08275 | Protein ID | WP_183609127.1 |
| Coordinates | 654173..654427 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMO82_RS08240 | 649046..649780 | + | 735 | WP_183609121.1 | PspA/IM30 family protein | - |
| QMO82_RS08245 | 649895..650620 | - | 726 | WP_183609122.1 | amino acid ABC transporter ATP-binding protein | - |
| QMO82_RS08250 | 650598..651257 | - | 660 | WP_183609123.1 | amino acid ABC transporter permease | - |
| QMO82_RS08255 | 651254..651925 | - | 672 | WP_183609124.1 | amino acid ABC transporter permease | - |
| QMO82_RS08260 | 652004..652789 | - | 786 | WP_183609125.1 | transporter substrate-binding domain-containing protein | - |
| QMO82_RS08265 | 652793..653536 | - | 744 | WP_183609126.1 | GntR family transcriptional regulator | - |
| QMO82_RS08270 | 653751..654176 | - | 426 | WP_097621818.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QMO82_RS08275 | 654173..654427 | - | 255 | WP_183609127.1 | plasmid stabilization protein | Antitoxin |
| QMO82_RS08280 | 654566..655336 | - | 771 | WP_183609128.1 | amino acid ABC transporter ATP-binding protein | - |
| QMO82_RS08285 | 655349..656008 | - | 660 | WP_097621821.1 | amino acid ABC transporter permease | - |
| QMO82_RS08290 | 656014..656676 | - | 663 | WP_183609129.1 | amino acid ABC transporter permease | - |
| QMO82_RS08295 | 656807..657646 | - | 840 | WP_183609130.1 | transporter substrate-binding domain-containing protein | - |
| QMO82_RS08300 | 658116..658763 | - | 648 | WP_183609131.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | gmd | 1..659089 | 659089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14985.18 Da Isoelectric Point: 4.4709
>T282236 WP_097621818.1 NZ_CP125651:c654176-653751 [Rhizobium sp. BT04]
MIILDTNVVSEAMKPAPDEAVKFWLDEQAAETLFLSSVTIAELMFGIGALPPGKRKERLSEALDGLMELFENRILAFDIT
AARHYADLAVKARAAGRGFPTPDGYIAAIAASKGFVVATRDTSAFDAAGVEVINPWAASAA
MIILDTNVVSEAMKPAPDEAVKFWLDEQAAETLFLSSVTIAELMFGIGALPPGKRKERLSEALDGLMELFENRILAFDIT
AARHYADLAVKARAAGRGFPTPDGYIAAIAASKGFVVATRDTSAFDAAGVEVINPWAASAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|