Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 542954..543621 | Replicon | plasmid pRspBT04f |
Accession | NZ_CP125651 | ||
Organism | Rhizobium sp. BT04 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QMO82_RS07750 | Protein ID | WP_183609707.1 |
Coordinates | 542954..543364 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QMO82_RS07755 | Protein ID | WP_183609706.1 |
Coordinates | 543361..543621 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO82_RS07730 | 538154..538975 | + | 822 | WP_183609711.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
QMO82_RS07735 | 539075..539491 | + | 417 | WP_183610957.1 | hypothetical protein | - |
QMO82_RS07740 | 539638..540555 | - | 918 | WP_183609709.1 | hydrogen peroxide-inducible genes activator | - |
QMO82_RS07745 | 540700..542889 | + | 2190 | WP_183609708.1 | catalase/peroxidase HPI | - |
QMO82_RS07750 | 542954..543364 | - | 411 | WP_183609707.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMO82_RS07755 | 543361..543621 | - | 261 | WP_183609706.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QMO82_RS07760 | 543743..544300 | - | 558 | WP_183609705.1 | DUF3299 domain-containing protein | - |
QMO82_RS07765 | 544511..544879 | - | 369 | WP_277545296.1 | SgcJ/EcaC family oxidoreductase | - |
QMO82_RS07770 | 544800..545042 | + | 243 | Protein_484 | hypothetical protein | - |
QMO82_RS07775 | 545227..545853 | + | 627 | WP_283196508.1 | HAMP domain-containing sensor histidine kinase | - |
QMO82_RS07780 | 545856..546322 | + | 467 | Protein_486 | response regulator | - |
QMO82_RS07785 | 546334..547479 | - | 1146 | WP_183609703.1 | ROK family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | gmd | 1..659089 | 659089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14967.23 Da Isoelectric Point: 6.4758
>T282235 WP_183609707.1 NZ_CP125651:c543364-542954 [Rhizobium sp. BT04]
VITHLIDTNAVIALIGRKSETLLKRVIDNDEGSIGLSTVVMHELYYGAYKSAKISYNLETLRLFMAEFSVIGFEQEDALA
AGKIRAALATKGTPIGPYDVLIAAQARTRDLVLVTNNVGEFRRVDGLRVEDWTVGR
VITHLIDTNAVIALIGRKSETLLKRVIDNDEGSIGLSTVVMHELYYGAYKSAKISYNLETLRLFMAEFSVIGFEQEDALA
AGKIRAALATKGTPIGPYDVLIAAQARTRDLVLVTNNVGEFRRVDGLRVEDWTVGR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|