Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 233650..234335 | Replicon | plasmid pRspBT03c |
| Accession | NZ_CP125644 | ||
| Organism | Rhizobium sp. BT03 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QMO80_RS30660 | Protein ID | WP_283201320.1 |
| Coordinates | 233650..234072 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QMO80_RS30665 | Protein ID | WP_283201321.1 |
| Coordinates | 234069..234335 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMO80_RS30640 (QMO80_006132) | 229610..230962 | + | 1353 | WP_283201316.1 | LLM class flavin-dependent oxidoreductase | - |
| QMO80_RS30645 (QMO80_006133) | 230973..231827 | + | 855 | WP_283201317.1 | ABC transporter permease | - |
| QMO80_RS30650 (QMO80_006134) | 231865..232848 | + | 984 | WP_283201318.1 | ABC transporter substrate-binding protein | - |
| QMO80_RS30655 (QMO80_006135) | 232858..233628 | + | 771 | WP_283201319.1 | ABC transporter ATP-binding protein | - |
| QMO80_RS30660 (QMO80_006136) | 233650..234072 | - | 423 | WP_283201320.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QMO80_RS30665 (QMO80_006137) | 234069..234335 | - | 267 | WP_283201321.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QMO80_RS30670 (QMO80_006138) | 234480..236291 | - | 1812 | WP_283201322.1 | chloride channel protein | - |
| QMO80_RS30675 (QMO80_006139) | 236495..236932 | + | 438 | WP_283201323.1 | helix-turn-helix domain-containing protein | - |
| QMO80_RS30680 (QMO80_006140) | 236956..237744 | - | 789 | WP_283201324.1 | ABC transporter ATP-binding protein | - |
| QMO80_RS30685 (QMO80_006141) | 237741..238793 | - | 1053 | WP_283201325.1 | iron ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..326235 | 326235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15539.83 Da Isoelectric Point: 4.9702
>T282233 WP_283201320.1 NZ_CP125644:c234072-233650 [Rhizobium sp. BT03]
VKLLLDTNVLSEVTKPSPDARVLQWLDRLDEDRAFVSIVSVAEIRRGVALMDKGRKRDALAEWLAQDLTQRFEHRIIPVD
EPVALAWGDLMGHAKPSGRGLSSMDGLIAATAIAHDLSLATRNTRDFEGFGIELIDPWIV
VKLLLDTNVLSEVTKPSPDARVLQWLDRLDEDRAFVSIVSVAEIRRGVALMDKGRKRDALAEWLAQDLTQRFEHRIIPVD
EPVALAWGDLMGHAKPSGRGLSSMDGLIAATAIAHDLSLATRNTRDFEGFGIELIDPWIV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|