Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 191686..192242 | Replicon | plasmid pRspBT03c |
| Accession | NZ_CP125644 | ||
| Organism | Rhizobium sp. BT03 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QMO80_RS30450 | Protein ID | WP_064829160.1 |
| Coordinates | 191952..192242 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QMO80_RS30445 | Protein ID | WP_283201282.1 |
| Coordinates | 191686..191964 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMO80_RS30425 (QMO80_006089) | 187074..187961 | - | 888 | WP_283201278.1 | sugar ABC transporter permease | - |
| QMO80_RS30430 (QMO80_006090) | 188054..189286 | - | 1233 | WP_283201279.1 | ABC transporter substrate-binding protein | - |
| QMO80_RS30435 (QMO80_006091) | 189344..190297 | - | 954 | WP_283201280.1 | sugar phosphate isomerase/epimerase | - |
| QMO80_RS30440 (QMO80_006092) | 190520..191590 | + | 1071 | WP_283201281.1 | LacI family DNA-binding transcriptional regulator | - |
| QMO80_RS30445 (QMO80_006093) | 191686..191964 | + | 279 | WP_283201282.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QMO80_RS30450 (QMO80_006094) | 191952..192242 | + | 291 | WP_064829160.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QMO80_RS30455 (QMO80_006095) | 192441..192872 | + | 432 | WP_283201283.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | - |
| QMO80_RS30460 (QMO80_006096) | 192872..194266 | + | 1395 | WP_283201284.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| QMO80_RS30465 (QMO80_006097) | 194263..194688 | + | 426 | WP_283201285.1 | acetyl-CoA carboxylase | - |
| QMO80_RS30470 (QMO80_006098) | 194685..195392 | + | 708 | WP_283201286.1 | 5-oxoprolinase subunit PxpB | - |
| QMO80_RS30475 (QMO80_006099) | 195389..196384 | + | 996 | WP_283201287.1 | biotin-dependent carboxyltransferase family protein | - |
| QMO80_RS30480 (QMO80_006100) | 196406..197173 | + | 768 | WP_283201288.1 | 5-oxoprolinase subunit PxpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..326235 | 326235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10955.74 Da Isoelectric Point: 10.2737
>T282232 WP_064829160.1 NZ_CP125644:191952-192242 [Rhizobium sp. BT03]
MPQVIFSPAAIRDLKRLREFLRPKNPSVAKRAGETILKGVSLLGTHPHMGRLIENLPEQYREWLIDFGESGYVARYRVDG
DILTILAVRHQKEAGF
MPQVIFSPAAIRDLKRLREFLRPKNPSVAKRAGETILKGVSLLGTHPHMGRLIENLPEQYREWLIDFGESGYVARYRVDG
DILTILAVRHQKEAGF
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|