Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 403503..404179 | Replicon | plasmid pRspBT03f |
| Accession | NZ_CP125641 | ||
| Organism | Rhizobium sp. BT03 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QMO80_RS23700 | Protein ID | WP_283200327.1 |
| Coordinates | 403754..404179 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QMO80_RS23695 | Protein ID | WP_283200326.1 |
| Coordinates | 403503..403757 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMO80_RS23675 (QMO80_004736) | 400305..401144 | + | 840 | WP_049734897.1 | transporter substrate-binding domain-containing protein | - |
| QMO80_RS23680 (QMO80_004737) | 401276..401938 | + | 663 | WP_283200323.1 | amino acid ABC transporter permease | - |
| QMO80_RS23685 (QMO80_004738) | 401944..402603 | + | 660 | WP_283200324.1 | amino acid ABC transporter permease | - |
| QMO80_RS23690 (QMO80_004739) | 402614..403384 | + | 771 | WP_283200325.1 | amino acid ABC transporter ATP-binding protein | - |
| QMO80_RS23695 (QMO80_004740) | 403503..403757 | + | 255 | WP_283200326.1 | plasmid stabilization protein | Antitoxin |
| QMO80_RS23700 (QMO80_004741) | 403754..404179 | + | 426 | WP_283200327.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QMO80_RS23705 (QMO80_004742) | 404378..405121 | + | 744 | WP_283200793.1 | GntR family transcriptional regulator | - |
| QMO80_RS23710 (QMO80_004743) | 405125..405910 | + | 786 | WP_283200328.1 | transporter substrate-binding domain-containing protein | - |
| QMO80_RS23715 (QMO80_004744) | 405986..406657 | + | 672 | WP_283200329.1 | amino acid ABC transporter permease | - |
| QMO80_RS23720 (QMO80_004745) | 406654..407313 | + | 660 | WP_283200330.1 | amino acid ABC transporter permease | - |
| QMO80_RS23725 (QMO80_004746) | 407291..408016 | + | 726 | WP_283200331.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..654550 | 654550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14987.10 Da Isoelectric Point: 4.4851
>T282231 WP_283200327.1 NZ_CP125641:403754-404179 [Rhizobium sp. BT03]
MIILDTNVVSEAMKPAPDDAVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLEELFEGRILAFDIT
AARHYADLAVKARAAGRGFPTPDGYIAAIAASKGFVVATRDTSAFDAAGVEVINPWATSRA
MIILDTNVVSEAMKPAPDDAVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLEELFEGRILAFDIT
AARHYADLAVKARAAGRGFPTPDGYIAAIAASKGFVVATRDTSAFDAAGVEVINPWATSRA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|