Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3833469..3834049 | Replicon | chromosome |
Accession | NZ_CP125640 | ||
Organism | Rhizobium sp. BT03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QMO80_RS18610 | Protein ID | WP_283197833.1 |
Coordinates | 3833666..3834049 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QMO80_RS18605 | Protein ID | WP_283197832.1 |
Coordinates | 3833469..3833669 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO80_RS18595 (QMO80_003719) | 3829817..3831556 | + | 1740 | WP_283197830.1 | L-arabinonate dehydratase | - |
QMO80_RS18600 (QMO80_003720) | 3831801..3833138 | - | 1338 | WP_283197831.1 | pilus assembly protein | - |
QMO80_RS18605 (QMO80_003721) | 3833469..3833669 | + | 201 | WP_283197832.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QMO80_RS18610 (QMO80_003722) | 3833666..3834049 | + | 384 | WP_283197833.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QMO80_RS18615 (QMO80_003723) | 3834123..3834371 | - | 249 | WP_283197834.1 | hypothetical protein | - |
QMO80_RS18620 (QMO80_003724) | 3834382..3834948 | - | 567 | WP_283197835.1 | hypothetical protein | - |
QMO80_RS18625 (QMO80_003725) | 3835109..3835780 | - | 672 | Protein_3664 | APC family permease | - |
QMO80_RS18630 (QMO80_003726) | 3835779..3836663 | + | 885 | WP_283197836.1 | MurR/RpiR family transcriptional regulator | - |
QMO80_RS18635 (QMO80_003727) | 3836838..3837599 | - | 762 | WP_283197837.1 | DMT family transporter | - |
QMO80_RS18640 (QMO80_003728) | 3837659..3838636 | + | 978 | WP_283197838.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14311.60 Da Isoelectric Point: 8.1328
>T282229 WP_283197833.1 NZ_CP125640:3833666-3834049 [Rhizobium sp. BT03]
VILADTSIWIDHFRHADAELRRIIEDDRLLCHPSVIGELALGSLRDRDRVMAFLAAQRGAVVATHDEVMTMINRYGIFSM
GIGYTDAHLLASVLLERRATLWTRDKRLRLAAEKAGVSLHIPVNTPR
VILADTSIWIDHFRHADAELRRIIEDDRLLCHPSVIGELALGSLRDRDRVMAFLAAQRGAVVATHDEVMTMINRYGIFSM
GIGYTDAHLLASVLLERRATLWTRDKRLRLAAEKAGVSLHIPVNTPR
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|