Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 2827148..2827689 | Replicon | chromosome |
Accession | NZ_CP125640 | ||
Organism | Rhizobium sp. BT03 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QMO80_RS13835 | Protein ID | WP_283197092.1 |
Coordinates | 2827148..2827444 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QMO80_RS13840 | Protein ID | WP_283197093.1 |
Coordinates | 2827441..2827689 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMO80_RS13815 (QMO80_002763) | 2823301..2823828 | + | 528 | WP_283197088.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QMO80_RS13820 (QMO80_002764) | 2823890..2824546 | + | 657 | WP_283197089.1 | thiamine diphosphokinase | - |
QMO80_RS13825 (QMO80_002765) | 2824550..2826370 | + | 1821 | WP_283197090.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
QMO80_RS13830 (QMO80_002766) | 2826489..2827118 | + | 630 | WP_283197091.1 | hypothetical protein | - |
QMO80_RS13835 (QMO80_002767) | 2827148..2827444 | - | 297 | WP_283197092.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QMO80_RS13840 (QMO80_002768) | 2827441..2827689 | - | 249 | WP_283197093.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QMO80_RS13845 (QMO80_002769) | 2827809..2829671 | - | 1863 | WP_283197094.1 | ABC transporter ATP-binding protein/permease | - |
QMO80_RS13850 (QMO80_002770) | 2829954..2830877 | + | 924 | WP_283197095.1 | homoserine O-succinyltransferase | - |
QMO80_RS13855 (QMO80_002771) | 2830971..2831993 | + | 1023 | WP_283197096.1 | aldose epimerase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2827148..2838802 | 11654 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11620.21 Da Isoelectric Point: 5.9705
>T282228 WP_283197092.1 NZ_CP125640:c2827444-2827148 [Rhizobium sp. BT03]
MKYRTTVEADYDIVDIYVLGANQFGLPQSERYVDDLFRAFELLADNPQMARERRELNPPIRLHPHHAHMIAYVIREEDIL
IVRVLHGRENWQSLFAQS
MKYRTTVEADYDIVDIYVLGANQFGLPQSERYVDDLFRAFELLADNPQMARERRELNPPIRLHPHHAHMIAYVIREEDIL
IVRVLHGRENWQSLFAQS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|