Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-Phd
Location 1085338..1086029 Replicon plasmid pRlBT01d
Accession NZ_CP125637
Organism Rhizobium leguminosarum strain BT01

Toxin (Protein)


Gene name vapC Uniprot ID A0A6P0D4X9
Locus tag QMO81_RS31465 Protein ID WP_018245712.1
Coordinates 1085338..1085766 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A4R0AD13
Locus tag QMO81_RS31470 Protein ID WP_017991284.1
Coordinates 1085763..1086029 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMO81_RS31435 (QMO81_006292) 1080374..1081177 - 804 WP_018444828.1 crotonase/enoyl-CoA hydratase family protein -
QMO81_RS31440 (QMO81_006293) 1081266..1081850 + 585 WP_026188704.1 TetR/AcrR family transcriptional regulator -
QMO81_RS31445 (QMO81_006294) 1082124..1082963 + 840 WP_018245715.1 transporter substrate-binding domain-containing protein -
QMO81_RS31450 (QMO81_006295) 1083131..1083793 + 663 WP_026188703.1 amino acid ABC transporter permease -
QMO81_RS31455 (QMO81_006296) 1083800..1084459 + 660 WP_011648868.1 amino acid ABC transporter permease -
QMO81_RS31460 (QMO81_006297) 1084472..1085242 + 771 WP_018245713.1 amino acid ABC transporter ATP-binding protein -
QMO81_RS31465 (QMO81_006298) 1085338..1085766 - 429 WP_018245712.1 type II toxin-antitoxin system VapC family toxin Toxin
QMO81_RS31470 (QMO81_006299) 1085763..1086029 - 267 WP_017991284.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QMO81_RS31475 (QMO81_006300) 1086286..1087035 + 750 WP_018245711.1 GntR family transcriptional regulator -
QMO81_RS31480 (QMO81_006301) 1087039..1087824 + 786 WP_018245710.1 transporter substrate-binding domain-containing protein -
QMO81_RS31485 (QMO81_006302) 1087905..1088576 + 672 WP_018245709.1 amino acid ABC transporter permease -
QMO81_RS31490 (QMO81_006303) 1088573..1089232 + 660 WP_018245708.1 amino acid ABC transporter permease -
QMO81_RS31495 (QMO81_006304) 1089210..1089935 + 726 WP_130746160.1 amino acid ABC transporter ATP-binding protein -
QMO81_RS31500 (QMO81_006305) 1090084..1090455 - 372 WP_018245706.1 type II toxin-antitoxin system RelE/ParE family toxin -
QMO81_RS31505 (QMO81_006306) 1090455..1090712 - 258 WP_018245705.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - katA 1..1334842 1334842


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-66)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15914.18 Da        Isoelectric Point: 4.6772

>T282223 WP_018245712.1 NZ_CP125637:c1085766-1085338 [Rhizobium leguminosarum]
VRLLLDTNVLSEVTRPRPDAHVLQWLDSLDEDRSFISVVSIAEIRRGVALMESGRKRDALAEWLAQDLPQRFEQRVIPVD
QPVAIAWGDLMGLAKRSGRGLSSMDGLIAATAIAHDLTLATRNIKDFEGFEIELVDPWTERP

Download         Length: 429 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9960.34 Da        Isoelectric Point: 10.0842

>AT282223 WP_017991284.1 NZ_CP125637:c1086029-1085763 [Rhizobium leguminosarum]
MQPSRPEDKSWTVASAKAKLSEVIERAQATPQTIMRNGKPSVVVVSAEEWQRKTARKGTLAEFLMQSPLRGADLDLERQR
DEPRDLQL

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6P0D4X9

Antitoxin

Source ID Structure
AlphaFold DB A0A4R0AD13

References