Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 3786186..3786853 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O50411 |
| Locus tag | O3Q54_RS17845 | Protein ID | WP_003417916.1 |
| Coordinates | 3786186..3786578 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
| Locus tag | O3Q54_RS17850 | Protein ID | WP_003912214.1 |
| Coordinates | 3786578..3786853 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS17830 (O3Q54_17830) | 3782206..3783361 | - | 1156 | Protein_3522 | 1-deoxy-D-xylulose-5-phosphate synthase N-terminal domain-containing protein | - |
| O3Q54_RS17835 (O3Q54_17835) | 3783391..3784380 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| O3Q54_RS17840 (O3Q54_17840) | 3784380..3785432 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
| O3Q54_RS17845 (O3Q54_17845) | 3786186..3786578 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS17850 (O3Q54_17850) | 3786578..3786853 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O3Q54_RS17855 (O3Q54_17855) | 3787035..3788406 | + | 1372 | Protein_3527 | ISNCY family transposase | - |
| O3Q54_RS17860 (O3Q54_17860) | 3788596..3790791 | + | 2196 | WP_010886168.1 | PE family protein | - |
| O3Q54_RS17865 (O3Q54_17865) | 3790862..3791734 | - | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3787729..3788406 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T282220 WP_003417916.1 NZ_CP125620:c3786578-3786186 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BXS8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E8U8S7 |