Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3689190..3689864 | Replicon | chromosome |
Accession | NZ_CP125620 | ||
Organism | Mycobacterium tuberculosis strain BLR 4299 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | O3Q54_RS17490 | Protein ID | WP_003417282.1 |
Coordinates | 3689190..3689618 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | O3Q54_RS17495 | Protein ID | WP_003417286.1 |
Coordinates | 3689622..3689864 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Q54_RS17465 (O3Q54_17465) | 3685012..3685413 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
O3Q54_RS17470 (O3Q54_17470) | 3685650..3685988 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
O3Q54_RS17475 (O3Q54_17475) | 3685985..3686419 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
O3Q54_RS17480 (O3Q54_17480) | 3686548..3688320 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
O3Q54_RS17485 (O3Q54_17485) | 3688320..3689111 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
O3Q54_RS17490 (O3Q54_17490) | 3689190..3689618 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O3Q54_RS17495 (O3Q54_17495) | 3689622..3689864 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
O3Q54_RS17500 (O3Q54_17500) | 3689986..3690600 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
O3Q54_RS17505 (O3Q54_17505) | 3690597..3691262 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
O3Q54_RS17510 (O3Q54_17510) | 3691263..3691796 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
O3Q54_RS17515 (O3Q54_17515) | 3691793..3692167 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
O3Q54_RS17525 (O3Q54_17525) | 3693622..3694758 | - | 1137 | WP_003417297.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T282218 WP_003417282.1 NZ_CP125620:c3689618-3689190 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |