Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3166020..3166707 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | O3Q54_RS15115 | Protein ID | WP_003414624.1 |
| Coordinates | 3166264..3166707 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | O3Q54_RS15110 | Protein ID | WP_003414620.1 |
| Coordinates | 3166020..3166277 (+) | Length | 86 a.a. |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T282216 WP_003414624.1 NZ_CP125620:3166264-3166707 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp