Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3166020..3166707 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | O3Q54_RS15115 | Protein ID | WP_003414624.1 |
| Coordinates | 3166264..3166707 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | O3Q54_RS15110 | Protein ID | WP_003414620.1 |
| Coordinates | 3166020..3166277 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS15090 (O3Q54_15090) | 3161340..3162194 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| O3Q54_RS15095 (O3Q54_15095) | 3162250..3163413 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| O3Q54_RS15100 (O3Q54_15100) | 3163430..3164644 | - | 1215 | WP_003899518.1 | zinc metalloprotease Rip | - |
| O3Q54_RS15105 (O3Q54_15105) | 3164652..3165893 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| O3Q54_RS15110 (O3Q54_15110) | 3166020..3166277 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| O3Q54_RS15115 (O3Q54_15115) | 3166264..3166707 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS15120 (O3Q54_15120) | 3166787..3167449 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| O3Q54_RS15125 (O3Q54_15125) | 3167545..3167736 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| O3Q54_RS15130 (O3Q54_15130) | 3168068..3169816 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| O3Q54_RS15135 (O3Q54_15135) | 3169912..3170493 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| O3Q54_RS15140 (O3Q54_15140) | 3170593..3170859 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T282216 WP_003414624.1 NZ_CP125620:3166264-3166707 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|