Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3119502..3120106 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag O3Q54_RS14885 Protein ID WP_003414492.1
Coordinates 3119502..3119894 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag O3Q54_RS14890 Protein ID WP_003414495.1
Coordinates 3119891..3120106 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS14855 (O3Q54_14855) 3114652..3115440 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
O3Q54_RS14860 (O3Q54_14860) 3115774..3116319 - 546 WP_003913758.1 DUF1802 family protein -
O3Q54_RS14865 (O3Q54_14865) 3116591..3117475 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
O3Q54_RS14870 (O3Q54_14870) 3117478..3118365 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
O3Q54_RS14875 (O3Q54_14875) 3118670..3119215 - 546 WP_003899500.1 DUF1802 family protein -
O3Q54_RS14880 (O3Q54_14880) 3119212..3119481 - 270 WP_003414489.1 DUF2277 family protein -
O3Q54_RS14885 (O3Q54_14885) 3119502..3119894 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
O3Q54_RS14890 (O3Q54_14890) 3119891..3120106 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O3Q54_RS14895 (O3Q54_14895) 3120153..3120902 + 750 WP_003414497.1 enoyl-CoA hydratase -
O3Q54_RS14900 (O3Q54_14900) 3120981..3122063 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
O3Q54_RS14905 (O3Q54_14905) 3122056..3123366 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
O3Q54_RS14910 (O3Q54_14910) 3123369..3124196 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
O3Q54_RS14915 (O3Q54_14915) 3124193..3125104 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T282214 WP_003414492.1 NZ_CP125620:c3119894-3119502 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT282214 WP_003414495.1 NZ_CP125620:c3120106-3119891 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References