Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3093762..3094332 | Replicon | chromosome |
Accession | NZ_CP125620 | ||
Organism | Mycobacterium tuberculosis strain BLR 4299 2019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | O3Q54_RS14740 | Protein ID | WP_003414166.1 |
Coordinates | 3093762..3094118 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | O3Q54_RS14745 | Protein ID | WP_003901465.1 |
Coordinates | 3094102..3094332 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Q54_RS14720 (O3Q54_14720) | 3089214..3090902 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
O3Q54_RS14725 (O3Q54_14725) | 3090906..3091232 | - | 327 | WP_003414157.1 | hypothetical protein | - |
O3Q54_RS14730 (O3Q54_14730) | 3091405..3091992 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
O3Q54_RS14735 (O3Q54_14735) | 3092011..3093660 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
O3Q54_RS14740 (O3Q54_14740) | 3093762..3094118 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
O3Q54_RS14745 (O3Q54_14745) | 3094102..3094332 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
O3Q54_RS14750 (O3Q54_14750) | 3094375..3095418 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
O3Q54_RS14755 (O3Q54_14755) | 3095417..3095884 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
O3Q54_RS14760 (O3Q54_14760) | 3096060..3096314 | - | 255 | WP_003917684.1 | hypothetical protein | - |
O3Q54_RS14765 (O3Q54_14765) | 3096462..3096866 | + | 405 | WP_009938577.1 | hypothetical protein | - |
O3Q54_RS14770 (O3Q54_14770) | 3096863..3097054 | + | 192 | WP_003414184.1 | hypothetical protein | - |
O3Q54_RS14775 (O3Q54_14775) | 3097271..3097531 | + | 261 | Protein_2916 | transposase | - |
O3Q54_RS14780 (O3Q54_14780) | 3098641..3098898 | + | 258 | WP_003899489.1 | hypothetical protein | - |
O3Q54_RS14785 (O3Q54_14785) | 3099003..3099314 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T282212 WP_003414166.1 NZ_CP125620:c3094118-3093762 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|