Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3054178..3054865 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag O3Q54_RS14520 Protein ID WP_003414064.1
Coordinates 3054470..3054865 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag O3Q54_RS14515 Protein ID WP_003414061.1
Coordinates 3054178..3054444 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS14490 (O3Q54_14490) 3049817..3050719 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
O3Q54_RS14495 (O3Q54_14495) 3050788..3051540 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
O3Q54_RS14500 (O3Q54_14500) 3051784..3052059 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
O3Q54_RS14505 (O3Q54_14505) 3052056..3053678 - 1623 WP_003906897.1 class I SAM-dependent DNA methyltransferase -
O3Q54_RS14510 (O3Q54_14510) 3053765..3054181 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
O3Q54_RS14515 (O3Q54_14515) 3054178..3054444 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
O3Q54_RS14520 (O3Q54_14520) 3054470..3054865 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
O3Q54_RS14525 (O3Q54_14525) 3054862..3055131 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
O3Q54_RS14530 (O3Q54_14530) 3055141..3056235 - 1095 WP_003414068.1 restriction endonuclease subunit S -
O3Q54_RS14535 (O3Q54_14535) 3056232..3056651 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
O3Q54_RS14540 (O3Q54_14540) 3056650..3056724 + 75 Protein_2869 hypothetical protein -
O3Q54_RS14545 (O3Q54_14545) 3056725..3057204 - 480 WP_003414073.1 dihydrofolate reductase -
O3Q54_RS14550 (O3Q54_14550) 3057275..3058075 - 801 WP_009939104.1 thymidylate synthase -
O3Q54_RS14555 (O3Q54_14555) 3058231..3058968 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T282211 WP_003414064.1 NZ_CP125620:c3054865-3054470 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT282211 WP_003414061.1 NZ_CP125620:c3054444-3054178 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References