Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3054178..3054865 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TF65 |
| Locus tag | O3Q54_RS14520 | Protein ID | WP_003414064.1 |
| Coordinates | 3054470..3054865 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | O3Q54_RS14515 | Protein ID | WP_003414061.1 |
| Coordinates | 3054178..3054444 (-) | Length | 89 a.a. |
Genomic Context
Location: 3056650..3056724 (75 bp)
Type: Others
Protein ID: Protein_2869
Type: Others
Protein ID: Protein_2869
Location: 3058231..3058968 (738 bp)
Type: Others
Protein ID: WP_003414079.1
Type: Others
Protein ID: WP_003414079.1
Location: 3049817..3050719 (903 bp)
Type: Others
Protein ID: WP_003900564.1
Type: Others
Protein ID: WP_003900564.1
Location: 3050788..3051540 (753 bp)
Type: Others
Protein ID: WP_003899465.1
Type: Others
Protein ID: WP_003899465.1
Location: 3051784..3052059 (276 bp)
Type: Others
Protein ID: WP_003414055.1
Type: Others
Protein ID: WP_003414055.1
Location: 3052056..3053678 (1623 bp)
Type: Others
Protein ID: WP_003906897.1
Type: Others
Protein ID: WP_003906897.1
Location: 3053765..3054181 (417 bp)
Type: Others
Protein ID: WP_003414059.1
Type: Others
Protein ID: WP_003414059.1
Location: 3054178..3054444 (267 bp)
Type: Antitoxin
Protein ID: WP_003414061.1
Type: Antitoxin
Protein ID: WP_003414061.1
Location: 3054470..3054865 (396 bp)
Type: Toxin
Protein ID: WP_003414064.1
Type: Toxin
Protein ID: WP_003414064.1
Location: 3054862..3055131 (270 bp)
Type: Others
Protein ID: WP_003414066.1
Type: Others
Protein ID: WP_003414066.1
Location: 3055141..3056235 (1095 bp)
Type: Others
Protein ID: WP_003414068.1
Type: Others
Protein ID: WP_003414068.1
Location: 3056232..3056651 (420 bp)
Type: Others
Protein ID: WP_003414070.1
Type: Others
Protein ID: WP_003414070.1
Location: 3056725..3057204 (480 bp)
Type: Others
Protein ID: WP_003414073.1
Type: Others
Protein ID: WP_003414073.1
Location: 3057275..3058075 (801 bp)
Type: Others
Protein ID: WP_009939104.1
Type: Others
Protein ID: WP_009939104.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS14490 (O3Q54_14490) | 3049817..3050719 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| O3Q54_RS14495 (O3Q54_14495) | 3050788..3051540 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| O3Q54_RS14500 (O3Q54_14500) | 3051784..3052059 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| O3Q54_RS14505 (O3Q54_14505) | 3052056..3053678 | - | 1623 | WP_003906897.1 | class I SAM-dependent DNA methyltransferase | - |
| O3Q54_RS14510 (O3Q54_14510) | 3053765..3054181 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
| O3Q54_RS14515 (O3Q54_14515) | 3054178..3054444 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O3Q54_RS14520 (O3Q54_14520) | 3054470..3054865 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS14525 (O3Q54_14525) | 3054862..3055131 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| O3Q54_RS14530 (O3Q54_14530) | 3055141..3056235 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
| O3Q54_RS14535 (O3Q54_14535) | 3056232..3056651 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
| O3Q54_RS14540 (O3Q54_14540) | 3056650..3056724 | + | 75 | Protein_2869 | hypothetical protein | - |
| O3Q54_RS14545 (O3Q54_14545) | 3056725..3057204 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| O3Q54_RS14550 (O3Q54_14550) | 3057275..3058075 | - | 801 | WP_009939104.1 | thymidylate synthase | - |
| O3Q54_RS14555 (O3Q54_14555) | 3058231..3058968 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T282211 WP_003414064.1 NZ_CP125620:c3054865-3054470 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp