Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2852951..2853660 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag O3Q54_RS13405 Protein ID WP_003413164.1
Coordinates 2852951..2853364 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag O3Q54_RS13410 Protein ID WP_003413167.1
Coordinates 2853403..2853660 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS13375 (O3Q54_13375) 2848004..2849209 - 1206 WP_003413027.1 chorismate synthase -
O3Q54_RS13380 (O3Q54_13380) 2849317..2849631 + 315 WP_009937839.1 hypothetical protein -
O3Q54_RS13385 (O3Q54_13385) 2849927..2851138 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
O3Q54_RS13390 (O3Q54_13390) 2851265..2851924 + 660 WP_014585545.1 LppA family lipoprotein -
O3Q54_RS13395 (O3Q54_13395) 2851921..2852583 + 663 WP_003900848.1 LppA family lipoprotein -
O3Q54_RS13400 (O3Q54_13400) 2852580..2852858 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
O3Q54_RS13405 (O3Q54_13405) 2852951..2853364 + 414 WP_003413164.1 PIN domain nuclease Toxin
O3Q54_RS13410 (O3Q54_13410) 2853403..2853660 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
O3Q54_RS13415 (O3Q54_13415) 2853657..2854034 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
O3Q54_RS13420 (O3Q54_13420) 2854050..2854424 - 375 WP_003413177.1 hypothetical protein -
O3Q54_RS13425 (O3Q54_13425) 2854524..2854919 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
O3Q54_RS13430 (O3Q54_13430) 2854916..2855161 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
O3Q54_RS13435 (O3Q54_13435) 2855572..2855991 - 420 WP_003413190.1 A24 family peptidase -
O3Q54_RS13440 (O3Q54_13440) 2856003..2856812 - 810 WP_003413193.1 shikimate dehydrogenase -
O3Q54_RS13445 (O3Q54_13445) 2856809..2858062 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
O3Q54_RS13450 (O3Q54_13450) 2858055..2858567 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T282205 WP_003413164.1 NZ_CP125620:2852951-2853364 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT282205 WP_003413167.1 NZ_CP125620:2853403-2853660 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References