Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2839064..2839704 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ08 |
| Locus tag | O3Q54_RS13320 | Protein ID | WP_003412970.1 |
| Coordinates | 2839064..2839483 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ09 |
| Locus tag | O3Q54_RS13325 | Protein ID | WP_003412975.1 |
| Coordinates | 2839480..2839704 (-) | Length | 75 a.a. |
Genomic Context
Location: 2835888..2836115 (228 bp)
Type: Others
Protein ID: WP_003412960.1
Type: Others
Protein ID: WP_003412960.1
Location: 2836112..2836513 (402 bp)
Type: Others
Protein ID: WP_003412963.1
Type: Others
Protein ID: WP_003412963.1
Location: 2838113..2839063 (951 bp)
Type: Others
Protein ID: WP_003911916.1
Type: Others
Protein ID: WP_003911916.1
Location: 2834649..2835371 (723 bp)
Type: Others
Protein ID: WP_003412957.1
Type: Others
Protein ID: WP_003412957.1
Location: 2836548..2837468 (921 bp)
Type: Others
Protein ID: WP_003412965.1
Type: Others
Protein ID: WP_003412965.1
Location: 2837809..2838054 (246 bp)
Type: Others
Protein ID: WP_071854223.1
Type: Others
Protein ID: WP_071854223.1
Location: 2839064..2839483 (420 bp)
Type: Toxin
Protein ID: WP_003412970.1
Type: Toxin
Protein ID: WP_003412970.1
Location: 2839480..2839704 (225 bp)
Type: Antitoxin
Protein ID: WP_003412975.1
Type: Antitoxin
Protein ID: WP_003412975.1
Location: 2839735..2842578 (2844 bp)
Type: Others
Protein ID: WP_003899363.1
Type: Others
Protein ID: WP_003899363.1
Location: 2842650..2843051 (402 bp)
Type: Others
Protein ID: WP_003412981.1
Type: Others
Protein ID: WP_003412981.1
Location: 2843051..2843521 (471 bp)
Type: Others
Protein ID: WP_003899364.1
Type: Others
Protein ID: WP_003899364.1
Location: 2843524..2844087 (564 bp)
Type: Others
Protein ID: WP_003412989.1
Type: Others
Protein ID: WP_003412989.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS13290 (O3Q54_13290) | 2834649..2835371 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
| O3Q54_RS13295 (O3Q54_13295) | 2835888..2836115 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| O3Q54_RS13300 (O3Q54_13300) | 2836112..2836513 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
| O3Q54_RS13305 (O3Q54_13305) | 2836548..2837468 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
| O3Q54_RS13310 (O3Q54_13310) | 2837809..2838054 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| O3Q54_RS13315 (O3Q54_13315) | 2838113..2839063 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
| O3Q54_RS13320 (O3Q54_13320) | 2839064..2839483 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS13325 (O3Q54_13325) | 2839480..2839704 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
| O3Q54_RS13330 (O3Q54_13330) | 2839735..2842578 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| O3Q54_RS13335 (O3Q54_13335) | 2842650..2843051 | - | 402 | WP_003412981.1 | hypothetical protein | - |
| O3Q54_RS13340 (O3Q54_13340) | 2843051..2843521 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
| O3Q54_RS13345 (O3Q54_13345) | 2843524..2844087 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T282204 WP_003412970.1 NZ_CP125620:c2839483-2839064 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp