Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2792880..2793532 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPX1 |
| Locus tag | O3Q54_RS13125 | Protein ID | WP_003412752.1 |
| Coordinates | 2793107..2793532 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | O3Q54_RS13120 | Protein ID | WP_003412749.1 |
| Coordinates | 2792880..2793101 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS13105 (O3Q54_13105) | 2791120..2791326 | - | 207 | WP_003899347.1 | hypothetical protein | - |
| O3Q54_RS13110 (O3Q54_13110) | 2791462..2792085 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
| O3Q54_RS13115 (O3Q54_13115) | 2792075..2792827 | + | 753 | WP_003900859.1 | hypothetical protein | - |
| O3Q54_RS13120 (O3Q54_13120) | 2792880..2793101 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| O3Q54_RS13125 (O3Q54_13125) | 2793107..2793532 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS13130 (O3Q54_13130) | 2793555..2794736 | - | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
| O3Q54_RS13135 (O3Q54_13135) | 2794733..2795779 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| O3Q54_RS13140 (O3Q54_13140) | 2795790..2796893 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| O3Q54_RS13145 (O3Q54_13145) | 2797152..2797973 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| O3Q54_RS13150 (O3Q54_13150) | 2797970..2798527 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T282203 WP_003412752.1 NZ_CP125620:2793107-2793532 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TPX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |