Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
| Location | 2213872..2214770 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | mbcT | Uniprot ID | P64908 |
| Locus tag | O3Q54_RS10375 | Protein ID | WP_003410001.1 |
| Coordinates | 2213872..2214432 (-) | Length | 187 a.a. |
Antitoxin (Protein)
| Gene name | mbcA | Uniprot ID | P64910 |
| Locus tag | O3Q54_RS10380 | Protein ID | WP_003410003.1 |
| Coordinates | 2214429..2214770 (-) | Length | 114 a.a. |
Genomic Context
Location: 2209809..2210039 (231 bp)
Type: Others
Protein ID: WP_003409980.1
Type: Others
Protein ID: WP_003409980.1
Location: 2211144..2211743 (600 bp)
Type: Others
Protein ID: WP_003409989.1
Type: Others
Protein ID: WP_003409989.1
Location: 2212159..2212587 (429 bp)
Type: Others
Protein ID: WP_003906713.1
Type: Others
Protein ID: WP_003906713.1
Location: 2212813..2213352 (540 bp)
Type: Others
Protein ID: WP_003900446.1
Type: Others
Protein ID: WP_003900446.1
Location: 2214856..2215113 (258 bp)
Type: Others
Protein ID: WP_003410006.1
Type: Others
Protein ID: WP_003410006.1
Location: 2209041..2209694 (654 bp)
Type: Others
Protein ID: WP_003409976.1
Type: Others
Protein ID: WP_003409976.1
Location: 2210124..2211035 (912 bp)
Type: Others
Protein ID: WP_003409986.1
Type: Others
Protein ID: WP_003409986.1
Location: 2213872..2214432 (561 bp)
Type: Toxin
Protein ID: WP_003410001.1
Type: Toxin
Protein ID: WP_003410001.1
Location: 2214429..2214770 (342 bp)
Type: Antitoxin
Protein ID: WP_003410003.1
Type: Antitoxin
Protein ID: WP_003410003.1
Location: 2215014..2215349 (336 bp)
Type: Others
Protein ID: WP_003410009.1
Type: Others
Protein ID: WP_003410009.1
Location: 2215438..2215782 (345 bp)
Type: Others
Protein ID: WP_003410010.1
Type: Others
Protein ID: WP_003410010.1
Location: 2215776..2216024 (249 bp)
Type: Others
Protein ID: WP_003410014.1
Type: Others
Protein ID: WP_003410014.1
Location: 2216124..2218439 (2316 bp)
Type: Others
Protein ID: WP_003899120.1
Type: Others
Protein ID: WP_003899120.1
Location: 2218436..2218708 (273 bp)
Type: Others
Protein ID: WP_003410017.1
Type: Others
Protein ID: WP_003410017.1
Location: 2218761..2219117 (357 bp)
Type: Others
Protein ID: WP_003410018.1
Type: Others
Protein ID: WP_003410018.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS10345 (O3Q54_10345) | 2209041..2209694 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
| O3Q54_RS10350 (O3Q54_10350) | 2209809..2210039 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
| O3Q54_RS10355 (O3Q54_10355) | 2210124..2211035 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
| O3Q54_RS10360 (O3Q54_10360) | 2211144..2211743 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
| O3Q54_RS10365 (O3Q54_10365) | 2212159..2212587 | + | 429 | WP_003906713.1 | cellulose-binding protein | - |
| O3Q54_RS10370 (O3Q54_10370) | 2212813..2213352 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
| O3Q54_RS10375 (O3Q54_10375) | 2213872..2214432 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
| O3Q54_RS10380 (O3Q54_10380) | 2214429..2214770 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
| O3Q54_RS10385 (O3Q54_10385) | 2214856..2215113 | + | 258 | WP_003410006.1 | hypothetical protein | - |
| O3Q54_RS10390 (O3Q54_10390) | 2215014..2215349 | - | 336 | WP_003410009.1 | dehydrogenase | - |
| O3Q54_RS10395 (O3Q54_10395) | 2215438..2215782 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
| O3Q54_RS10400 (O3Q54_10400) | 2215776..2216024 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
| O3Q54_RS10405 (O3Q54_10405) | 2216124..2218439 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
| O3Q54_RS10410 (O3Q54_10410) | 2218436..2218708 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
| O3Q54_RS10415 (O3Q54_10415) | 2218761..2219117 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T282196 WP_003410001.1 NZ_CP125620:c2214432-2213872 [Mycobacterium tuberculosis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT282196 WP_003410003.1 NZ_CP125620:c2214770-2214429 [Mycobacterium tuberculosis]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| PDB | 6FKG |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| PDB | 6FKG | |
| AlphaFold DB | A0A7U4FAE4 |