Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2183454..2183998 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag O3Q54_RS10200 Protein ID WP_003409896.1
Coordinates 2183454..2183750 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag O3Q54_RS10205 Protein ID WP_003409899.1
Coordinates 2183747..2183998 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS10145 (O3Q54_10145) 2178487..2178837 - 351 WP_003899096.1 hypothetical protein -
O3Q54_RS10150 (O3Q54_10150) 2178848..2179750 - 903 WP_003899097.1 hypothetical protein -
O3Q54_RS10155 (O3Q54_10155) 2179771..2179962 - 192 WP_003409876.1 hypothetical protein -
O3Q54_RS10160 (O3Q54_10160) 2179963..2180259 - 297 WP_003409877.1 hypothetical protein -
O3Q54_RS10165 (O3Q54_10165) 2180499..2180714 + 216 WP_003409878.1 antitoxin -
O3Q54_RS10170 (O3Q54_10170) 2180711..2181022 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
O3Q54_RS10175 (O3Q54_10175) 2180996..2181517 - 522 WP_003904745.1 hypothetical protein -
O3Q54_RS10180 (O3Q54_10180) 2181492..2181869 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
O3Q54_RS10185 (O3Q54_10185) 2181911..2182360 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
O3Q54_RS10190 (O3Q54_10190) 2182357..2182902 + 546 WP_003409891.1 SecB-like chaperone -
O3Q54_RS10195 (O3Q54_10195) 2182791..2183405 - 615 WP_003901296.1 hypothetical protein -
O3Q54_RS10200 (O3Q54_10200) 2183454..2183750 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O3Q54_RS10205 (O3Q54_10205) 2183747..2183998 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
O3Q54_RS10210 (O3Q54_10210) 2183985..2184479 + 495 WP_003899099.1 hypothetical protein -
O3Q54_RS10215 (O3Q54_10215) 2184639..2185046 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
O3Q54_RS10220 (O3Q54_10220) 2185050..2185322 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
O3Q54_RS10225 (O3Q54_10225) 2185355..2186575 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
O3Q54_RS10230 (O3Q54_10230) 2187474..2188271 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T282194 WP_003409896.1 NZ_CP125620:c2183750-2183454 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT282194 WP_003409899.1 NZ_CP125620:c2183998-2183747 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References