Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2174417..2175120 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | O3Q54_RS10110 | Protein ID | WP_003409778.1 |
| Coordinates | 2174417..2174746 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | O3Q54_RS10115 | Protein ID | WP_003409780.1 |
| Coordinates | 2174743..2175120 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS10090 (O3Q54_10090) | 2170800..2171870 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
| O3Q54_RS10095 (O3Q54_10095) | 2171867..2172382 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
| O3Q54_RS10100 (O3Q54_10100) | 2172379..2173440 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| O3Q54_RS10105 (O3Q54_10105) | 2173437..2174207 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| O3Q54_RS10110 (O3Q54_10110) | 2174417..2174746 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O3Q54_RS10115 (O3Q54_10115) | 2174743..2175120 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| O3Q54_RS10120 (O3Q54_10120) | 2175117..2175707 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
| O3Q54_RS10125 (O3Q54_10125) | 2175762..2177126 | + | 1365 | WP_023642649.1 | HNH endonuclease signature motif containing protein | - |
| O3Q54_RS10130 (O3Q54_10130) | 2177281..2177733 | - | 453 | WP_003899095.1 | lipoprotein | - |
| O3Q54_RS10135 (O3Q54_10135) | 2177797..2178198 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| O3Q54_RS10140 (O3Q54_10140) | 2178191..2178373 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| O3Q54_RS10145 (O3Q54_10145) | 2178487..2178837 | - | 351 | WP_003899096.1 | hypothetical protein | - |
| O3Q54_RS10150 (O3Q54_10150) | 2178848..2179750 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| O3Q54_RS10155 (O3Q54_10155) | 2179771..2179962 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T282192 WP_003409778.1 NZ_CP125620:c2174746-2174417 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT282192 WP_003409780.1 NZ_CP125620:c2175120-2174743 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|