Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1938117..1938730 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA2 |
| Locus tag | O3Q54_RS09040 | Protein ID | WP_003408465.1 |
| Coordinates | 1938117..1938506 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | O3Q54_RS09045 | Protein ID | WP_003408469.1 |
| Coordinates | 1938503..1938730 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS09005 (O3Q54_09005) | 1933747..1934661 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
| O3Q54_RS09010 (O3Q54_09010) | 1934664..1935494 | + | 831 | WP_003906661.1 | cyclase family protein | - |
| O3Q54_RS09015 (O3Q54_09015) | 1935494..1935843 | + | 350 | Protein_1779 | cupin domain-containing protein | - |
| O3Q54_RS09020 (O3Q54_09020) | 1935896..1936714 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
| O3Q54_RS09025 (O3Q54_09025) | 1936728..1937507 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| O3Q54_RS09035 (O3Q54_09035) | 1937938..1938069 | + | 132 | Protein_1782 | IS3 family transposase | - |
| O3Q54_RS09040 (O3Q54_09040) | 1938117..1938506 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS09045 (O3Q54_09045) | 1938503..1938730 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| O3Q54_RS09050 (O3Q54_09050) | 1938948..1940432 | + | 1485 | WP_009937637.1 | biotin carboxylase | - |
| O3Q54_RS09055 (O3Q54_09055) | 1940429..1941676 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
| O3Q54_RS09060 (O3Q54_09060) | 1941719..1942138 | - | 420 | WP_003408483.1 | hypothetical protein | - |
| O3Q54_RS09065 (O3Q54_09065) | 1942128..1942838 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T282190 WP_003408465.1 NZ_CP125620:c1938506-1938117 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUI9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7E4J | |
| AlphaFold DB | A0A7U4FAN9 |