Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1385786..1386474 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | O3Q54_RS06625 | Protein ID | WP_003406304.1 |
| Coordinates | 1386043..1386474 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | O3Q54_RS06620 | Protein ID | WP_003406302.1 |
| Coordinates | 1385786..1386046 (+) | Length | 87 a.a. |
Genomic Context
Location: 1381363..1382187 (825 bp)
Type: Others
Protein ID: WP_003900298.1
Type: Others
Protein ID: WP_003900298.1
Location: 1382192..1383373 (1182 bp)
Type: Others
Protein ID: WP_003406299.1
Type: Others
Protein ID: WP_003406299.1
Location: 1384721..1385710 (990 bp)
Type: Others
Protein ID: WP_003406301.1
Type: Others
Protein ID: WP_003406301.1
Location: 1385786..1386046 (261 bp)
Type: Antitoxin
Protein ID: WP_003406302.1
Type: Antitoxin
Protein ID: WP_003406302.1
Location: 1386043..1386474 (432 bp)
Type: Toxin
Protein ID: WP_003406304.1
Type: Toxin
Protein ID: WP_003406304.1
Location: 1388365..1389225 (861 bp)
Type: Others
Protein ID: WP_003900301.1
Type: Others
Protein ID: WP_003900301.1
Location: 1383450..1384550 (1101 bp)
Type: Others
Protein ID: WP_003406300.1
Type: Others
Protein ID: WP_003406300.1
Location: 1386497..1388185 (1689 bp)
Type: Others
Protein ID: WP_003910308.1
Type: Others
Protein ID: WP_003910308.1
Location: 1389306..1390136 (831 bp)
Type: Others
Protein ID: WP_003898788.1
Type: Others
Protein ID: WP_003898788.1
Location: 1390193..1390486 (294 bp)
Type: Others
Protein ID: WP_003898789.1
Type: Others
Protein ID: WP_003898789.1
Location: 1390483..1390752 (270 bp)
Type: Others
Protein ID: WP_003406322.1
Type: Others
Protein ID: WP_003406322.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS06600 (O3Q54_06600) | 1381363..1382187 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| O3Q54_RS06605 (O3Q54_06605) | 1382192..1383373 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
| O3Q54_RS06610 (O3Q54_06610) | 1383450..1384550 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| O3Q54_RS06615 (O3Q54_06615) | 1384721..1385710 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| O3Q54_RS06620 (O3Q54_06620) | 1385786..1386046 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| O3Q54_RS06625 (O3Q54_06625) | 1386043..1386474 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS06630 (O3Q54_06630) | 1386497..1388185 | - | 1689 | WP_003910308.1 | PE family protein | - |
| O3Q54_RS06635 (O3Q54_06635) | 1388365..1389225 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
| O3Q54_RS06640 (O3Q54_06640) | 1389306..1390136 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| O3Q54_RS06645 (O3Q54_06645) | 1390193..1390486 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| O3Q54_RS06650 (O3Q54_06650) | 1390483..1390752 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T282184 WP_003406304.1 NZ_CP125620:1386043-1386474 [Mycobacterium tuberculosis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp