Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1240921..1241489 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag O3Q54_RS05950 Protein ID WP_003405865.1
Coordinates 1241115..1241489 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag O3Q54_RS05945 Protein ID WP_003405863.1
Coordinates 1240921..1241118 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS05925 (O3Q54_05925) 1236962..1237600 - 639 WP_003898730.1 lipid droplet-associated protein -
O3Q54_RS05930 (O3Q54_05930) 1237690..1238697 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
O3Q54_RS05935 (O3Q54_05935) 1238714..1239697 - 984 WP_003898731.1 hypothetical protein -
O3Q54_RS05940 (O3Q54_05940) 1239760..1240833 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
O3Q54_RS05945 (O3Q54_05945) 1240921..1241118 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
O3Q54_RS05950 (O3Q54_05950) 1241115..1241489 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
O3Q54_RS05955 (O3Q54_05955) 1241692..1242390 + 699 WP_003898733.1 hypothetical protein -
O3Q54_RS05960 (O3Q54_05960) 1242508..1242693 + 186 WP_003901093.1 hypothetical protein -
O3Q54_RS05965 (O3Q54_05965) 1242620..1242895 - 276 WP_003405867.1 hypothetical protein -
O3Q54_RS05970 (O3Q54_05970) 1243138..1243461 + 324 WP_003405871.1 putative quinol monooxygenase -
O3Q54_RS05975 (O3Q54_05975) 1243476..1244174 - 699 WP_031646953.1 hypothetical protein -
O3Q54_RS05980 (O3Q54_05980) 1244208..1244417 + 210 WP_003911400.1 hypothetical protein -
O3Q54_RS05985 (O3Q54_05985) 1244369..1245139 - 771 Protein_1179 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T282183 WP_003405865.1 NZ_CP125620:1241115-1241489 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT282183 WP_003405863.1 NZ_CP125620:1240921-1241118 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References