Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1232165..1232796 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P9WIH8 |
| Locus tag | O3Q54_RS05895 | Protein ID | WP_003898728.1 |
| Coordinates | 1232165..1232476 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | O3Q54_RS05900 | Protein ID | WP_003405836.1 |
| Coordinates | 1232476..1232796 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS05875 (O3Q54_05875) | 1227646..1229070 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
| O3Q54_RS05880 (O3Q54_05880) | 1229101..1230189 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
| O3Q54_RS05885 (O3Q54_05885) | 1230245..1230889 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| O3Q54_RS05890 (O3Q54_05890) | 1230896..1232053 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| O3Q54_RS05895 (O3Q54_05895) | 1232165..1232476 | - | 312 | WP_003898728.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| O3Q54_RS05900 (O3Q54_05900) | 1232476..1232796 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| O3Q54_RS05905 (O3Q54_05905) | 1232806..1234342 | + | 1537 | Protein_1163 | carboxylesterase/lipase family protein | - |
| O3Q54_RS05910 (O3Q54_05910) | 1234349..1235461 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| O3Q54_RS05915 (O3Q54_05915) | 1235471..1235728 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| O3Q54_RS05920 (O3Q54_05920) | 1235718..1236965 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| O3Q54_RS05925 (O3Q54_05925) | 1236962..1237600 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11049.76 Da Isoelectric Point: 4.9371
>T282182 WP_003898728.1 NZ_CP125620:c1232476-1232165 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|