Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 841476..842185 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF74 |
| Locus tag | O3Q54_RS03970 | Protein ID | WP_003403837.1 |
| Coordinates | 841757..842185 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TEX4 |
| Locus tag | O3Q54_RS03965 | Protein ID | WP_003403834.1 |
| Coordinates | 841476..841733 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS03960 (O3Q54_03960) | 838980..841385 | + | 2406 | WP_012054245.1 | PE family protein | - |
| O3Q54_RS03965 (O3Q54_03965) | 841476..841733 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| O3Q54_RS03970 (O3Q54_03970) | 841757..842185 | + | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS03975 (O3Q54_03975) | 842266..842403 | - | 138 | WP_003403839.1 | hypothetical protein | - |
| O3Q54_RS03980 (O3Q54_03980) | 842562..842807 | + | 246 | WP_003403841.1 | hypothetical protein | - |
| O3Q54_RS03985 (O3Q54_03985) | 842876..843760 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| O3Q54_RS03990 (O3Q54_03990) | 843771..844943 | - | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
| O3Q54_RS03995 (O3Q54_03995) | 844950..846482 | - | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T282178 WP_003403837.1 NZ_CP125620:841757-842185 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CDR3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TEX4 |