Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 755053..755593 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P9WII0 |
| Locus tag | O3Q54_RS03480 | Protein ID | WP_003403376.1 |
| Coordinates | 755053..755361 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TQE0 |
| Locus tag | O3Q54_RS03485 | Protein ID | WP_003403381.1 |
| Coordinates | 755348..755593 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS03455 (O3Q54_03455) | 750368..751873 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| O3Q54_RS03460 (O3Q54_03460) | 751954..752964 | + | 1011 | WP_009937374.1 | ABC transporter ATP-binding protein | - |
| O3Q54_RS03465 (O3Q54_03465) | 753352..753735 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
| O3Q54_RS03470 (O3Q54_03470) | 753830..753985 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| O3Q54_RS03475 (O3Q54_03475) | 754061..754777 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| O3Q54_RS03480 (O3Q54_03480) | 755053..755361 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| O3Q54_RS03485 (O3Q54_03485) | 755348..755593 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| O3Q54_RS03490 (O3Q54_03490) | 755703..756140 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS03495 (O3Q54_03495) | 756137..756391 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| O3Q54_RS03500 (O3Q54_03500) | 756505..758868 | + | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
| O3Q54_RS03505 (O3Q54_03505) | 758931..759257 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| O3Q54_RS03510 (O3Q54_03510) | 759169..759507 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
| O3Q54_RS03515 (O3Q54_03515) | 759504..759677 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T282175 WP_003403376.1 NZ_CP125620:c755361-755053 [Mycobacterium tuberculosis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSE5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQE0 |