Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 703079..703722 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | O3Q54_RS03195 | Protein ID | WP_003403187.1 |
| Coordinates | 703321..703722 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | O3Q54_RS03190 | Protein ID | WP_003403184.1 |
| Coordinates | 703079..703324 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS03155 (O3Q54_03155) | 698359..698889 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| O3Q54_RS03160 (O3Q54_03160) | 698873..699568 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| O3Q54_RS03165 (O3Q54_03165) | 699691..700002 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| O3Q54_RS03170 (O3Q54_03170) | 700074..701024 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| O3Q54_RS03175 (O3Q54_03175) | 701265..701849 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| O3Q54_RS03180 (O3Q54_03180) | 701851..702561 | + | 711 | Protein_630 | IS607 family element RNA-guided endonuclease TnpB | - |
| O3Q54_RS03185 (O3Q54_03185) | 702564..703034 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| O3Q54_RS03190 (O3Q54_03190) | 703079..703324 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O3Q54_RS03195 (O3Q54_03195) | 703321..703722 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS03200 (O3Q54_03200) | 703713..703892 | + | 180 | Protein_634 | hypothetical protein | - |
| O3Q54_RS03205 (O3Q54_03205) | 704310..704507 | - | 198 | WP_003403191.1 | hypothetical protein | - |
| O3Q54_RS03210 (O3Q54_03210) | 704587..705744 | - | 1158 | WP_031713721.1 | hypothetical protein | - |
| O3Q54_RS03215 (O3Q54_03215) | 705796..706017 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| O3Q54_RS03220 (O3Q54_03220) | 706159..706764 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T282170 WP_003403187.1 NZ_CP125620:703321-703722 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |