Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
| Location | 696989..697635 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ88 |
| Locus tag | O3Q54_RS03140 | Protein ID | WP_003403137.1 |
| Coordinates | 696989..697402 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ89 |
| Locus tag | O3Q54_RS03145 | Protein ID | WP_003403139.1 |
| Coordinates | 697399..697635 (-) | Length | 79 a.a. |
Genomic Context
Location: 693072..694622 (1551 bp)
Type: Others
Protein ID: WP_003403119.1
Type: Others
Protein ID: WP_003403119.1
Location: 699691..700002 (312 bp)
Type: Others
Protein ID: WP_003403164.1
Type: Others
Protein ID: WP_003403164.1
Location: 700074..701024 (951 bp)
Type: Others
Protein ID: WP_003900184.1
Type: Others
Protein ID: WP_003900184.1
Location: 701265..701849 (585 bp)
Type: Others
Protein ID: WP_003403171.1
Type: Others
Protein ID: WP_003403171.1
Location: 701851..702561 (711 bp)
Type: Others
Protein ID: Protein_630
Type: Others
Protein ID: Protein_630
Location: 694674..695066 (393 bp)
Type: Others
Protein ID: WP_003403122.1
Type: Others
Protein ID: WP_003403122.1
Location: 695063..695320 (258 bp)
Type: Others
Protein ID: WP_003403125.1
Type: Others
Protein ID: WP_003403125.1
Location: 695503..696738 (1236 bp)
Type: Others
Protein ID: WP_003403128.1
Type: Others
Protein ID: WP_003403128.1
Location: 696989..697402 (414 bp)
Type: Toxin
Protein ID: WP_003403137.1
Type: Toxin
Protein ID: WP_003403137.1
Location: 697399..697635 (237 bp)
Type: Antitoxin
Protein ID: WP_003403139.1
Type: Antitoxin
Protein ID: WP_003403139.1
Location: 697739..698245 (507 bp)
Type: Others
Protein ID: WP_003900973.1
Type: Others
Protein ID: WP_003900973.1
Location: 698359..698889 (531 bp)
Type: Others
Protein ID: WP_003917320.1
Type: Others
Protein ID: WP_003917320.1
Location: 698873..699568 (696 bp)
Type: Others
Protein ID: WP_003918099.1
Type: Others
Protein ID: WP_003918099.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS03120 (O3Q54_03120) | 693072..694622 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
| O3Q54_RS03125 (O3Q54_03125) | 694674..695066 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
| O3Q54_RS03130 (O3Q54_03130) | 695063..695320 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
| O3Q54_RS03135 (O3Q54_03135) | 695503..696738 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| O3Q54_RS03140 (O3Q54_03140) | 696989..697402 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS03145 (O3Q54_03145) | 697399..697635 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | Antitoxin |
| O3Q54_RS03150 (O3Q54_03150) | 697739..698245 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| O3Q54_RS03155 (O3Q54_03155) | 698359..698889 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| O3Q54_RS03160 (O3Q54_03160) | 698873..699568 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| O3Q54_RS03165 (O3Q54_03165) | 699691..700002 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| O3Q54_RS03170 (O3Q54_03170) | 700074..701024 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| O3Q54_RS03175 (O3Q54_03175) | 701265..701849 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| O3Q54_RS03180 (O3Q54_03180) | 701851..702561 | + | 711 | Protein_630 | IS607 family element RNA-guided endonuclease TnpB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T282169 WP_003403137.1 NZ_CP125620:c697402-696989 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp