Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 694674..695320 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag O3Q54_RS03125 Protein ID WP_003403122.1
Coordinates 694674..695066 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag O3Q54_RS03130 Protein ID WP_003403125.1
Coordinates 695063..695320 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS03110 (O3Q54_03110) 690336..691862 + 1527 WP_003403112.1 virulence factor Mce family protein -
O3Q54_RS03115 (O3Q54_03115) 691925..693067 + 1143 WP_003911253.1 virulence factor Mce family protein -
O3Q54_RS03120 (O3Q54_03120) 693072..694622 + 1551 WP_003403119.1 MlaD family protein -
O3Q54_RS03125 (O3Q54_03125) 694674..695066 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
O3Q54_RS03130 (O3Q54_03130) 695063..695320 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
O3Q54_RS03135 (O3Q54_03135) 695503..696738 - 1236 WP_003403128.1 ATP-binding protein -
O3Q54_RS03140 (O3Q54_03140) 696989..697402 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
O3Q54_RS03145 (O3Q54_03145) 697399..697635 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 -
O3Q54_RS03150 (O3Q54_03150) 697739..698245 - 507 WP_003900973.1 two component system sensor kinase HK1 -
O3Q54_RS03155 (O3Q54_03155) 698359..698889 - 531 WP_003917320.1 two component system sensor kinase HK2 -
O3Q54_RS03160 (O3Q54_03160) 698873..699568 - 696 WP_003918099.1 two-component system response regulator TcrA -
O3Q54_RS03165 (O3Q54_03165) 699691..700002 + 312 WP_003403164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T282168 WP_003403122.1 NZ_CP125620:c695066-694674 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT282168 WP_003403125.1 NZ_CP125620:c695320-695063 [Mycobacterium tuberculosis]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References