Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 694674..695320 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O07783 |
| Locus tag | O3Q54_RS03125 | Protein ID | WP_003403122.1 |
| Coordinates | 694674..695066 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ86 |
| Locus tag | O3Q54_RS03130 | Protein ID | WP_003403125.1 |
| Coordinates | 695063..695320 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS03110 (O3Q54_03110) | 690336..691862 | + | 1527 | WP_003403112.1 | virulence factor Mce family protein | - |
| O3Q54_RS03115 (O3Q54_03115) | 691925..693067 | + | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
| O3Q54_RS03120 (O3Q54_03120) | 693072..694622 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
| O3Q54_RS03125 (O3Q54_03125) | 694674..695066 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
| O3Q54_RS03130 (O3Q54_03130) | 695063..695320 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
| O3Q54_RS03135 (O3Q54_03135) | 695503..696738 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| O3Q54_RS03140 (O3Q54_03140) | 696989..697402 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
| O3Q54_RS03145 (O3Q54_03145) | 697399..697635 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
| O3Q54_RS03150 (O3Q54_03150) | 697739..698245 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| O3Q54_RS03155 (O3Q54_03155) | 698359..698889 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| O3Q54_RS03160 (O3Q54_03160) | 698873..699568 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| O3Q54_RS03165 (O3Q54_03165) | 699691..700002 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T282168 WP_003403122.1 NZ_CP125620:c695066-694674 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F8V4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ86 |