Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
| Location | 640072..640748 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPQ9 |
| Locus tag | O3Q54_RS02890 | Protein ID | WP_003898500.1 |
| Coordinates | 640072..640485 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TPR0 |
| Locus tag | O3Q54_RS02895 | Protein ID | WP_003402915.1 |
| Coordinates | 640482..640748 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS02860 (O3Q54_02860) | 635417..635719 | - | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
| O3Q54_RS02865 (O3Q54_02865) | 635779..636057 | - | 279 | WP_003402901.1 | hypothetical protein | - |
| O3Q54_RS02870 (O3Q54_02870) | 636054..637307 | - | 1254 | WP_003402904.1 | inorganic phosphate transporter | - |
| O3Q54_RS02875 (O3Q54_02875) | 637427..637813 | - | 387 | WP_003402907.1 | VOC family protein | - |
| O3Q54_RS02880 (O3Q54_02880) | 637876..638760 | - | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
| O3Q54_RS02885 (O3Q54_02885) | 638856..639758 | - | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| O3Q54_RS02890 (O3Q54_02890) | 640072..640485 | - | 414 | WP_003898500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O3Q54_RS02895 (O3Q54_02895) | 640482..640748 | - | 267 | WP_003402915.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| O3Q54_RS02900 (O3Q54_02900) | 640940..642655 | - | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
| O3Q54_RS02905 (O3Q54_02905) | 642733..644337 | + | 1605 | WP_003402920.1 | amidohydrolase | - |
| O3Q54_RS02910 (O3Q54_02910) | 644334..645314 | + | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T282166 WP_003898500.1 NZ_CP125620:c640485-640072 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|