Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0299-vapB/- |
| Location | 366004..366575 | Replicon | chromosome |
| Accession | NZ_CP125620 | ||
| Organism | Mycobacterium tuberculosis strain BLR 4299 2019 | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | O3Q54_RS01590 | Protein ID | WP_003401560.1 |
| Coordinates | 366004..366306 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O07227 |
| Locus tag | O3Q54_RS01595 | Protein ID | WP_003401563.1 |
| Coordinates | 366354..366575 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3Q54_RS01570 (O3Q54_01570) | 361719..362522 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
| O3Q54_RS01575 (O3Q54_01575) | 362532..363929 | - | 1398 | WP_003401544.1 | sulfatase | - |
| O3Q54_RS01580 (O3Q54_01580) | 364108..365637 | + | 1530 | WP_014585493.1 | PE family protein | - |
| O3Q54_RS01585 (O3Q54_01585) | 365780..366007 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
| O3Q54_RS01590 (O3Q54_01590) | 366004..366306 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
| O3Q54_RS01595 (O3Q54_01595) | 366354..366575 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| O3Q54_RS01600 (O3Q54_01600) | 366572..366997 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
| O3Q54_RS01605 (O3Q54_01605) | 367133..367765 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| O3Q54_RS01610 (O3Q54_01610) | 367762..368670 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
| O3Q54_RS01615 (O3Q54_01615) | 368678..369268 | - | 591 | WP_229298012.1 | hypothetical protein | - |
| O3Q54_RS01620 (O3Q54_01620) | 369261..369311 | - | 51 | Protein_320 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T282163 WP_003401560.1 NZ_CP125620:366004-366306 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|