Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 71627..72260 | Replicon | chromosome |
Accession | NZ_CP125620 | ||
Organism | Mycobacterium tuberculosis strain BLR 4299 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFC0 |
Locus tag | O3Q54_RS00360 | Protein ID | WP_003400580.1 |
Coordinates | 71859..72260 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P0CW29 |
Locus tag | O3Q54_RS00355 | Protein ID | WP_003400577.1 |
Coordinates | 71627..71866 (+) | Length | 80 a.a. |
Genomic Context
Location: 66924..68363 (1440 bp)
Type: Others
Protein ID: WP_003901784.1
Type: Others
Protein ID: WP_003901784.1
Location: 68419..68580 (162 bp)
Type: Others
Protein ID: WP_003899796.1
Type: Others
Protein ID: WP_003899796.1
Location: 68621..71560 (2940 bp)
Type: Others
Protein ID: WP_031648427.1
Type: Others
Protein ID: WP_031648427.1
Location: 71627..71866 (240 bp)
Type: Antitoxin
Protein ID: WP_003400577.1
Type: Antitoxin
Protein ID: WP_003400577.1
Location: 71859..72260 (402 bp)
Type: Toxin
Protein ID: WP_003400580.1
Type: Toxin
Protein ID: WP_003400580.1
Location: 75339..76250 (912 bp)
Type: Others
Protein ID: WP_003899798.1
Type: Others
Protein ID: WP_003899798.1
Location: 72312..74549 (2238 bp)
Type: Others
Protein ID: WP_003899797.1
Type: Others
Protein ID: WP_003899797.1
Location: 74667..75236 (570 bp)
Type: Others
Protein ID: WP_003400591.1
Type: Others
Protein ID: WP_003400591.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Q54_RS00340 (O3Q54_00340) | 66924..68363 | + | 1440 | WP_003901784.1 | FAD-binding oxidoreductase | - |
O3Q54_RS00345 (O3Q54_00345) | 68419..68580 | + | 162 | WP_003899796.1 | hypothetical protein | - |
O3Q54_RS00350 (O3Q54_00350) | 68621..71560 | + | 2940 | WP_031648427.1 | UPF0182 family protein | - |
O3Q54_RS00355 (O3Q54_00355) | 71627..71866 | + | 240 | WP_003400577.1 | antitoxin VapB1 | Antitoxin |
O3Q54_RS00360 (O3Q54_00360) | 71859..72260 | + | 402 | WP_003400580.1 | type II toxin-antitoxin system ribonuclease VapC1 | Toxin |
O3Q54_RS00365 (O3Q54_00365) | 72312..74549 | - | 2238 | WP_003899797.1 | NADP-dependent isocitrate dehydrogenase | - |
O3Q54_RS00370 (O3Q54_00370) | 74667..75236 | - | 570 | WP_003400591.1 | TetR/AcrR family transcriptional regulator | - |
O3Q54_RS00375 (O3Q54_00375) | 75339..76250 | + | 912 | WP_003899798.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.44 Da Isoelectric Point: 4.8887
>T282161 WP_003400580.1 NZ_CP125620:71859-72260 [Mycobacterium tuberculosis]
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
Download Length: 402 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BR82 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHM7 |